KEGG   Pantoea vagans C9-1: Pvag_3247Help
Entry
Pvag_3247         CDS       T01326                                 

Gene name
ygiY
Definition
(GenBank) probable two-component system sensor histidine kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
pva  Pantoea vagans C9-1
Pathway
pva02020  Two-component system
pva02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pva00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Pvag_3247 (ygiY)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Pvag_3247 (ygiY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pva01001]
    Pvag_3247 (ygiY)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pva02022]
    Pvag_3247 (ygiY)
Enzymes [BR:pva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     Pvag_3247 (ygiY)
Protein kinases [BR:pva01001]
 Histidine kinases
  OmpR family
   Pvag_3247 (ygiY)
Two-component system [BR:pva02022]
 OmpR family
  QseC-QseB (quorum sensing)
   Pvag_3247 (ygiY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HAMP HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ADO11385
UniProt: E1SJC8
Position
3427538..3428893
Genome map
AA seq 451 aa AA seqDB search
MRSMSLFLRLGIGFVLLLGLCWTSASLSAWHQTRETLDELFDTQQMLLAKRLLTLDFSSL
DNTTLPRTKAMLRHHRGDQDDDALAFAVFTRDGRQVMNDGDNGRYLPFEADYQGFHEGQL
TNDDDRWRFVWLTTPDQKFRVVVGQELEYRDDITQDLMKASMLPWLIALPFMLLLLIGLV
WSELRPLKTLAQQLAQRAPDDDTPLQADRVPKEVQPLMMALNGLFSRISAMMQRERRFTS
DAAHELRSPLAALQVQSEVIQLTADDEVMRTHALQQLDAGIARATRLVDQLLTLSRVEAD
DARSAFEPVALKRTVQETIAAQLPLADKTGVTLRLHAEADPQIQGHPLLMSLLVRNLLDN
AIRYTPAGSEVDVRLQANSLSVEDNGEGLSAADLQRLGERFWRPPGQEKSGSGLGLSIVR
NIAQLHGMQVTFSQRPGGGLCVTLRWSAPAP
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcaatgagcctgtttctgcggctgggcatcggtttcgtgctgctgctcggcctt
tgctggaccagtgccagcctgagtgcctggcatcagacccgtgaaacccttgatgagctg
tttgatacccagcagatgctgctggccaagcgcctgctgacgctggatttctcttcgctg
gacaacaccacattgccccgaaccaaagcgatgctgcggcaccatcgtggcgatcaggat
gacgatgccctggcctttgctgtcttcacacgtgacggcaggcaggtgatgaatgatggc
gataatggccgctatctgccgtttgaggcggactatcagggatttcatgaaggacagctc
accaatgatgacgatcgctggcggtttgtctggctgaccacgccggatcaaaagttccgg
gtagtcgtcggtcaggagttggaataccgcgacgacataacacaggatctgatgaaagcc
agtatgctgccctggctgatcgcgctgccgtttatgctgctgttactcatcggactggtc
tggtctgaactgcgaccgctgaagacgctggcgcagcagctggcgcagcgcgcgcctgat
gacgatacgccgctgcaggcagaccgcgtgccgaaagaggtacagccgctgatgatggcg
ctcaatggcctgttcagccgcatcagcgccatgatgcagcgtgaacgtcgctttacctcc
gatgccgcacatgagctgcgcagtccgctggccgctctgcaggtgcaaagcgaagtgatc
cagctgacggcggatgacgaagtgatgcgaacccatgcgctgcaacagctggatgccggc
attgcacgcgctacgcggctggtggatcagctgctgacgctttcgcgggttgaagccgat
gatgcacgcagcgccttcgaaccggtggcgctgaaacgcacggtgcaggagacgatcgcc
gcacaattgccgctggccgataaaaccggcgtcaccctgcggctgcacgcggaggccgat
ccgcagattcagggtcatccactgttaatgtcactgctggtgcggaatctgctggataac
gccattcgctatacgcctgcgggcagcgaagtcgatgtgcggttgcaggcaaacagcctg
tcggtagaggataacggtgagggtctgagtgctgccgacctgcaacggctcggtgagcgt
ttctggcgaccgccaggtcaggagaagagcgggagcgggctgggattatcgatagtgcgt
aatattgcccagttgcatgggatgcaggttacgttcagccagcgacccggcggcggcttg
tgcgtcacgctacgctggtcagcgcccgccccgtaa

DBGET integrated database retrieval system