KEGG   Pantoea vagans C9-1: Pvag_3340Help
Entry
Pvag_3340         CDS       T01326                                 

Gene name
ggtA
Definition
(GenBank) putative gamma-glutamyltranspeptidase precursor
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00430  Taurine and hypotaurine metabolism
pva00460  Cyanoamino acid metabolism
pva00480  Glutathione metabolism
pva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Pvag_3340 (ggtA)
   00460 Cyanoamino acid metabolism
    Pvag_3340 (ggtA)
   00480 Glutathione metabolism
    Pvag_3340 (ggtA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pva01002]
    Pvag_3340 (ggtA)
Enzymes [BR:pva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     Pvag_3340 (ggtA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     Pvag_3340 (ggtA)
Peptidases and inhibitors [BR:pva01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   Pvag_3340 (ggtA)
CD molecules [BR:pva04090]
 Proteins
  Pvag_3340 (ggtA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ADO11478
UniProt: E1SK29
Position
complement(3530468..3532066)
Genome map
AA seq 532 aa AA seqDB search
MRETDFNVGYPSHRVPMMGRNAVATSQPLAAQAGLRMLQQGGNAVDAAIATAIALTVLEP
TGNGIGSDAFAIVWDGSELHGLNASGRAPAAWRPERFAALSAMPETGWESVTVPGAVSAW
VTLAQRFGTLPLTTLAQPAIDYARDGFPVSPLIGQLWQRGYDKLRDQPGFSSCFAPQGRP
PRTGELFRNPAQARTLQEIAETEGESFYRGALAQKMAAFAREHGAALTLEDLKNHRADWV
TLLSHPFAGGSVQELPPNGQGIATLIALGILEAWEINRYAPDSPQWLHLSIEAMKLALVD
LDRYVTDEDHLEFPTELLLSKEYIRQRAALIDPDKAGDFRFGSPQQSGTVYVAAADASGM
MVSFIQSNYMGFGSGVVVPDTGISLQNRGAGFSLDPEHPNVVAGGKRPFHTIIPAFALDQ
QGQPLMAFGVMGGPMQAQGHVQLALRIMLHRQNPQAAIDAPRWRVVQGREVVFESTLDRN
TLSTLRRMGHNVVLEDPLSNYNFGGAQVIVRDPQGFYIAASESRKDGQAVVF
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaaacagattttaacgtcggctatccctctcatcgcgtgccgatgatgggccgc
aatgccgtcgcaacctcgcaaccgctggcggcacaggcgggtttacggatgctgcaacag
ggtgggaacgccgtggatgcggctatcgccaccgccatcgccttaaccgtgctggagccg
accggaaacggcatcggcagtgatgcgtttgcgattgtctgggacggcagcgagctgcat
ggcttaaatgcttcaggtcgggcgcccgccgcctggcgtcccgaacgctttgccgctctg
agcgcgatgcctgaaaccggctgggagtctgtcactgtgccgggcgccgtctcggcgtgg
gtgacgctggcgcagcgcttcggcaccttaccgctgaccaccctggcgcaaccggcaatt
gactatgcgcgcgacggctttccggtctctccgctgattggtcagctgtggcagcgtggc
tatgacaagctgcgcgatcagcctggcttcagcagctgctttgcgccgcagggccgtcca
ccgcgtacgggtgagctgttccgcaacccggcgcaggcccgcaccctgcaggagattgct
gagactgagggtgaaagtttttatcgcggcgcactggcgcagaaaatggcggccttcgcc
cgcgaacatggcgcggcgctgacgctggaggatttaaaaaaccatcgtgctgactgggtt
accctgctgtcgcatccgtttgctggcggatcggtgcaggagctgccgccgaatggtcag
gggatcgcgaccttaattgcgctcggcattctggaagcgtgggagatcaatcgctatgca
cccgattcaccgcagtggctgcatctttctattgaggcgatgaaactggcgctggttgat
ctggaccgttatgtcactgacgaggatcaccttgaatttccgactgaattactcctgagc
aaagagtacatccgccagcgggcagcattaatcgaccctgataaagcaggagatttccgc
tttggatcaccgcagcaaagcggcacggtgtatgtcgcggcagcggatgccagcggcatg
atggtctctttcatccagtccaattacatgggctttggctctggcgtggtcgtacccgat
accggcatcagcctgcagaaccgtggcgcaggcttttcactcgacccggagcatcccaac
gttgtggcgggcggtaaacggcctttccataccatcattccggcctttgcgctggatcag
cagggccagccgctgatggcgtttggcgtgatgggcggcccgatgcaggcgcagggacac
gttcagctggcgctgcggattatgctgcaccggcagaatccgcaggccgcgattgatgcg
ccgcgctggcgcgtggtacagggacgtgaggtggtgtttgaatccactctcgatcgcaat
accctgagcacgctgcgccgtatggggcacaatgtggtgctggaagaccctctgagtaac
tacaactttggtggcgcacaggtaatcgtacgcgatccgcagggcttctatatcgcagcc
agcgagagtcgcaaagatggtcaggcggtagtgttttaa

DBGET integrated database retrieval system