KEGG   Pantoea vagans C9-1: Pvag_3400Help
Entry
Pvag_3400         CDS       T01326                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00860  Porphyrin and chlorophyll metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
pva01120  Microbial metabolism in diverse environments
Module
pva_M00121  Heme biosynthesis, glutamate => heme
pva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pvag_3400 (hemD)
Enzymes [BR:pva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pvag_3400 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADO11532
UniProt: E1SKN2
Position
complement(3605245..3605973)
Genome map
AA seq 242 aa AA seqDB search
MTILVTRPEPAAAELVSRLHALGKQAWSLPLIEFAPGADLDSLPHKLAGLRAGDLVFILS
QQVIHYAQHAIKAWPTELDYYAIGRSTALAFHTVSGQQVTWPHAHETSEELIRINTLQQV
AGKRALILRGDPGRELLAETLTRRGAEVTFAACYQRCQKHYDGPVEGRRWRDRGVSVLVV
TSGEMLQQLFSLFPAVDREEWLLNCRLIVVSERLATLAAGLGWQDIQVADGADNDALLRA
LR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcctggtgacgcgcccggaacccgcagcggcagagctggtgtcacgcctgcat
gcccttggcaaacaggcgtggagcctgccgctaatcgaatttgcaccgggcgctgacctc
gactccctgcctcacaagctcgccggacttcgtgctggcgacctcgtctttattctttct
cagcaggttattcactacgcccagcacgcgatcaaagcatggcccactgagctggactat
tatgcaattggtcgcagcacagcgctggcgtttcacaccgtcagcggacagcaggtgacc
tggcctcatgcgcatgaaaccagtgaggaattgatcaggataaacacgcttcagcaggtt
gccggtaaacgtgcgctgattctgcgtggcgatcctggacgcgaattgctggcggagaca
ttaacccggcgaggtgctgaggtaacgtttgctgcctgctaccagcgctgccagaagcat
tatgacgggccggttgaaggccgccgctggcgcgatcgcggcgtctctgtgctggtggtg
accagcggtgaaatgttacaacagcttttttcgctattccccgcggttgatcgcgaggaa
tggctgctcaactgccgactgatagtcgtcagtgaacgtttggctaccctggccgcagga
ttgggttggcaggatattcaggtagccgatggtgccgataacgatgcgctgctgcgcgcg
ttacgctga

DBGET integrated database retrieval system