KEGG   Pantoea vagans C9-1: Pvag_3712Help
Entry
Pvag_3712         CDS       T01326                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00240  Pyrimidine metabolism
pva00250  Alanine, aspartate and glutamate metabolism
pva01100  Metabolic pathways
Module
pva_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pvag_3712 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pvag_3712 (pyrB)
Enzymes [BR:pva01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pvag_3712 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADO11828
UniProt: E1SCZ8
Position
complement(3951660..3952595)
Genome map
AA seq 311 aa AA seqDB search
MPNPLYRKHIISINDLSREELELALHTAAKLKAHPQPELLKHKVIASCFFEASTRTRLSF
ETAIHRLGASAVGFADGSNTSLGKKGETLADTISVIGTYVDAIVMRHPQEGAARLATEFS
GGIPILNAGDGANQHPTQTLLDLFTIQETQSRLNQLNVAMVGDLKYGRTVHSLTQALAKF
DGNRFFFIAPDALAMPAYITDMLDEKNIAWSRHDSFEEVMPQLDILYMTRVQKERLDPSE
YANVKAQFILRAADLSTARDNMKVMHPLPRIDEITTDVDKTPYAWYFQQAGNGIYARQAL
LALVLNSELAL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcctaacccgctatatcgcaagcacattatttcaatcaacgacctcagtcgtgaagag
ctggaactggcgctgcacaccgccgcaaagttgaaagcccatccgcagccggaactgctg
aagcacaaggtgatcgccagctgcttctttgaggcctcgacccgtacccgcctgtcgttt
gaaactgcgatccatcgcctgggcgcgtcagcggtgggctttgcggacggcagtaacacc
tcgctgggcaaaaaaggcgaaaccctggccgacaccatttccgtcatcggcacctacgtt
gatgcgatcgtgatgcgtcatccgcaggaaggcgcggcgcgactggcgaccgagttctcc
ggcggtatcccgattctcaacgccggtgacggcgcaaaccagcatccgacccagacgctg
ctcgatctcttcaccattcaggagacgcagagccgtcttaatcagctgaatgtggcgatg
gtcggcgacctgaagtatggccgcaccgtgcactccctgacgcaggcgctggcgaagttt
gatggcaaccgtttctttttcatcgcacccgatgcgctggcgatgccggcctatatcacc
gacatgctggatgagaagaacatcgcctggtcacggcacgacagttttgaagaggtgatg
ccgcagctcgatatcctctacatgacccgggtgcagaaagagcggctcgacccgtccgaa
tatgccaacgttaaagcacagttcattctgcgcgctgccgacctcagcacagcgcgcgac
aacatgaaggtgatgcacccgctgccgcgcatcgacgagatcaccaccgatgtcgataaa
accccgtatgcctggtatttccagcaggcgggtaacggcatctatgcgcgccaggctctg
ctggcactggttttaaacagcgaactcgccctgtaa

DBGET integrated database retrieval system