KEGG   Pantoea vagans C9-1: Pvag_pPag20165Help
Entry
Pvag_pPag20165    CDS       T01326                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00250  Alanine, aspartate and glutamate metabolism
pva01100  Metabolic pathways
pva01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pva00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pvag_pPag20165 (asnB)
Enzymes [BR:pva01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Pvag_pPag20165 (asnB)
Peptidases [BR:pva01002]
 Cysteine Peptidases
  Family C44
   Pvag_pPag20165 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase DUF3700 QueC
Motif
Other DBs
NCBI-ProteinID: ADO08155
UniProt: E1PKW3
Position
pPag2:109232..111055
Genome map
AA seq 607 aa AA seqDB search
MCGIAGVINYRRQPTQPSMLSSMLASLKHRGPDQEGVYHQEHVSIGMRRLKIIALDNGAQ
PCYSNDGRYVLVFNGEIYNYRRLRAELIAQGFRFETESDAEVIVNLYQRDGEAFYQRLDG
MFALAIYDRIDDTLLLARDPAGKKPLFYAVHDGIVSFSSELNSLLKDQRIPRHIDPVALD
YFLRFRVVPGDRCIFQNISKVPAGGGVSFAHGKESRQHYWRVNYQPESDEKPLEQWVDEI
DEYLNQAISKRLMAEVPIGTMLSGGLDSSLITAIACKQSRHKLKTFAVGFNESAFSELEY
SRRLAKDLGTEHHDFIITPGEAFDAAHDLVKHFGEPFAFPSSIASHFMYRLARQHVAVVL
GGDGADELFGGYARYSLVANFPHLPAEHKLPRKVDLLNKTWRADAFPEFYQALLTDGVGG
QLRQQLYSRSMALRLAEEGSVAQVRRYRDELMMHSDPLSAAMEYDFNHWMQEAQMVKVDI
ASMANSLEVRAPFLDRQIVGFGSRLPGQLKLHAGKEKYLLQCLAKRYLPAYIVDRKKQEL
AVPLEQWMVSSMKTLIIDTLTSEQALSRGYFNPDKLRQFVREFDGSHSYALWTLYMLEKW
HQQFFDN
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattgcaggggtcatcaactatcgtcgccagccgacgcagccttcaatgtta
tcgtcaatgttagcttctctgaagcaccgtggtccagatcaagaaggtgtctatcatcaa
gagcatgtcagcataggcatgcggcgtttaaaaatcatcgctctggataatggcgcacag
ccctgttacagcaatgacgggcgatatgttctggtatttaacggtgaaatctacaattac
cggcgtttacgtgctgagttgatagctcagggatttagatttgaaactgaatccgatgcg
gaagtaatagttaacctctatcaacgggacggtgaagccttttatcagcgactggatggc
atgttcgctctagccatttacgacagaatcgacgatacactgctactggctcgcgacccg
gcaggtaagaaaccactgttttatgctgttcatgatggtattgtcagcttctcttctgaa
ctgaactccttactaaaagatcaacgtattccacgccatattgatccggtggcgctggat
tattttctgcgctttcgtgtggttccgggcgatcgctgtattttccaaaacataagtaaa
gtgccagccggtggaggtgtcagcttcgcgcacggaaaggaaagccgacagcattattgg
cgcgtgaattaccagccagagtcggatgaaaagccgctggaacagtgggttgacgagatc
gatgagtatttgaaccaggctatctctaaacgtttgatggcggaagtgccaattggcacc
atgcttagcggcgggcttgattcaagcctgattactgccatcgcctgcaagcagagccga
cataagctgaaaaccttcgctgtgggcttcaatgaatctgcatttagcgaactggagtac
tcccgaaggctggcaaaggatctgggtacagagcatcatgatttcatcattacaccggga
gaggctttcgacgcggcacatgatctggtaaagcactttggtgagccttttgcttttcct
tcttcaatagccagtcactttatgtatcgtctggcacgtcagcacgtggcggtagtactc
ggcggtgatggggcagatgaattatttggtgggtatgcccgttactcgttggtagcaaat
ttcccccatttacccgctgagcataaactgccgcgcaaggttgacctgttaaataagaca
tggcgtgcagatgcattccccgaattttatcaggcgcttttaaccgatggcgtaggaggt
caattacgccaacaactctatagcagatcaatggcactacggttagccgaagagggtagc
gttgcacaggtaagacgctatcgcgatgaactaatgatgcactcagaccctctttctgct
gctatggaatatgatttcaatcactggatgcaggaagctcagatggtcaaggtggacatc
gcatcaatggctaactcgcttgaggtacgcgccccttttctggacaggcagattgttggt
tttggaagtcgtttgccgggacagctcaaactccatgccgggaaggagaaatacctcctg
caatgtctggcgaagcgctacctgccagcctatattgttgaccgaaaaaaacaggaactt
gccgttcctctggagcagtggatggtatcgtcgatgaaaaccctcatcattgatactctg
accagcgagcaggcattatctcgcggctattttaatcctgacaaattacgccaattcgtc
agggaatttgacggtagccatagttatgcactgtggacactgtatatgctggaaaaatgg
caccaacagttttttgataattag

DBGET integrated database retrieval system