KEGG   Pantoea vagans C9-1: Pvag_pPag30438Help
Entry
Pvag_pPag30438    CDS       T01326                                 

Definition
(GenBank) Thiamine biosynthesis protein THI22 precursor
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
pva  Pantoea vagans C9-1
Pathway
pva00730  Thiamine metabolism
pva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Pvag_pPag30438
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pva03000]
    Pvag_pPag30438
Enzymes [BR:pva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     Pvag_pPag30438
Transcription factors [BR:pva03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Pvag_pPag30438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: ADI78507
UniProt: D6YR74
Position
pPag3:434678..435379
Genome map
AA seq 233 aa AA seqDB search
MTHPLFETGFYGRLRHQAGTQWHDYVRHNFVQQLGHGTLPPAAFRHYLTQDYLFLLHFAR
AWGLLISKLSEPAALRSATASLNAIISELPLHLAYCQQWGISEEAMASETEAMETINYTR
YVLDVGHTGDALELMTALMPCVAGYAEIGLRLLEDPATRFGGNPYAAWIENYGDESYLAG
VGSSLMLFETLAQQRAGEQRINSLSEIFTTATRLEAAFWQMGLNYADCLQVSS
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgacacatccgcttttcgaaaccggcttttatggtcgtctgcgccatcaggcgggcacg
caatggcacgattatgtcaggcacaattttgtgcagcagctcggacacggcacgctgcca
cccgccgcttttcgtcactatctcacccaggattatctgtttctgctgcacttcgcccgt
gcatggggtctgttgatcagcaaactctcagaaccggctgcattacgcagcgcgacggca
tcgctgaacgccattatcagcgaactgccgctgcatctggcttactgccagcagtggggc
atcagcgaagaggcgatggcgagcgaaacggaggcaatggaaacgatcaactacacccgt
tacgtgctggacgtgggtcacaccggagatgcgctggagctgatgacggcgctgatgcca
tgcgtcgccggttatgcggaaatcggcctgaggctgctggaggatcccgcgacccgcttc
ggggggaatccttacgcggcatggattgagaattacggtgatgagtcctacctggcgggc
gtcggttcttcactgatgctgtttgaaactctggctcagcagcgcgccggtgaacagcgt
attaactcactgtcggagattttcaccaccgcaacccggctggaagcggcattctggcag
atggggcttaattatgctgactgtctgcaggtcagctcatga

DBGET integrated database retrieval system