KEGG   Pandoraea vervacti: UC34_05355Help
Entry
UC34_05355        CDS       T03688                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pve  Pandoraea vervacti
Pathway
pve00430  Taurine and hypotaurine metabolism
pve00460  Cyanoamino acid metabolism
pve00480  Glutathione metabolism
pve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    UC34_05355
   00460 Cyanoamino acid metabolism
    UC34_05355
   00480 Glutathione metabolism
    UC34_05355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pve01002]
    UC34_05355
Enzymes [BR:pve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     UC34_05355
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     UC34_05355
Peptidases and inhibitors [BR:pve01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   UC34_05355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: AJP56578
UniProt: A0A0C5JNR8
Position
1171312..1172949
Genome map
AA seq 545 aa AA seqDB search
MTQFNWQNPYPTPRLPVFARNIVSTSHPLAAQAGLRILWQGGNAVDAAIAAAACMTIVEP
VSNGLGGDCFALVWDGKQVHGLNASGTAPGAWSVDYFRKKYGEEHGIAKQPMRGLDTVTV
PGVIAGWEALHAKFGKLPFADLMAPAIEIAERGHAVAHIVARKWAAAVPELKDQPGYAQT
FMPNGRAPTTSEMMRMPGHARTLRLLAKEGPRAFYEGEIAERIAAWNVEHGGAMTADDLR
AYRADWVTPIEKDYRGYTVHEIPPNGQGIAALIALGILDKFDVSSHAVDRVHSQHLQIEA
MKLAFADLYKYVADPRSMEVTPAQMLDDGYLTERAKLINPDKATHFDFGMPKSGGTIYLT
AADEQGMMVSFIQSNYMGFGSGVVVPDYGIALQNRGCGFSMDPKSANVVEGGKRPFHTII
PAFLTQKVDGRHEAVMSFGVMGGDMQPQGHLQSVVRMLDYGQQPQAACDAPRWKVNRDFT
VDIESTMNRETVEGLVALGHKLKSIDDPYMDFGSGQYIWRLDRNDPERGYVAASDSRRDG
LAAGY
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaattcaactggcaaaacccttatccgacgccgcgcctgccggtgttcgcccgc
aacatcgtgtcgacgtcgcatccgctcgcggcgcaagccggtctgcgcattctgtggcag
ggcggcaatgccgtcgacgccgcgattgccgccgccgcgtgcatgaccatcgtcgagccg
gtatccaacggtctgggcggggactgctttgcgctcgtgtgggacggcaagcaggtgcac
ggcctgaacgcgtcgggcaccgcgccgggcgcgtggagtgtcgactacttccgcaagaag
tacggcgaggagcacggcattgccaaacagccgatgcgcggactcgacacggtcaccgtg
cccggcgtgatcgccggttgggaagcgctgcacgcgaagtttggcaagttgccgttcgcc
gacctgatggccccggccatcgagatcgctgagcgcggtcacgccgtggcgcacatcgtc
gcgcgcaaatgggcggcggccgtgcccgagctgaaagaccagccgggttacgcgcaaacc
ttcatgccgaacggccgcgcaccgaccaccagcgagatgatgcgcatgccggggcatgcc
cgtacgctgcgcctgctcgccaaggaaggtccgcgcgcgttctatgagggcgagatcgcc
gagcgtatcgccgcgtggaacgtcgagcacggcggggcgatgaccgccgatgatctgcgc
gcctatcgcgcggactgggtcacgcccatcgaaaaggactatcgcggctataccgtgcac
gagattccgccgaacggccagggcattgccgcgctgattgcgctgggcattctcgacaag
ttcgacgtctccagccacgcagtggaccgcgtgcattcgcagcacttgcagatcgaggcg
atgaagctcgccttcgccgatctctacaagtacgtggccgacccgcgttcgatggaagtc
acgcccgcgcagatgctcgacgacggctacctcaccgaacgcgcgaagctcatcaacccc
gacaaggcgacgcacttcgactttggcatgccgaagtccggcggcacgatctacctgacg
gcggccgacgaacagggcatgatggtcagcttcatccagtcgaactacatgggattcggt
tcgggcgtggtggtgccggattacggcatcgcgctgcaaaaccgcggctgcggtttctcg
atggatccgaagtcggcgaacgtggtcgagggcggcaagcgcccgttccacacgatcatt
ccggcattcctcacgcagaaggtcgacggtcggcacgaggccgtgatgagcttcggggtg
atgggcggcgacatgcagccgcagggccacttgcagtcggtcgttcgcatgctcgactac
ggtcagcagccgcaggcggcatgcgatgcgccgcggtggaaggtcaatcgcgacttcacc
gtcgatatcgagtcgacgatgaatcgagagacggtggaaggtctggtcgcgctcggccac
aagctgaagtccatcgacgatccgtacatggacttcggctcgggccagtacatctggcgt
ctggatcgcaacgatccggagcgcggctacgtggccgcgagcgacagccgtcgcgacggc
ctcgctgccgggtactga

DBGET integrated database retrieval system