KEGG   Pandoraea vervacti: UC34_06780Help
Entry
UC34_06780        CDS       T03688                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pve  Pandoraea vervacti
Pathway
pve00071  Fatty acid degradation
pve00072  Synthesis and degradation of ketone bodies
pve00280  Valine, leucine and isoleucine degradation
pve00310  Lysine degradation
pve00362  Benzoate degradation
pve00380  Tryptophan metabolism
pve00620  Pyruvate metabolism
pve00630  Glyoxylate and dicarboxylate metabolism
pve00640  Propanoate metabolism
pve00650  Butanoate metabolism
pve00900  Terpenoid backbone biosynthesis
pve01100  Metabolic pathways
pve01110  Biosynthesis of secondary metabolites
pve01120  Microbial metabolism in diverse environments
pve01130  Biosynthesis of antibiotics
pve01200  Carbon metabolism
pve01212  Fatty acid metabolism
pve02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UC34_06780
   00630 Glyoxylate and dicarboxylate metabolism
    UC34_06780
   00640 Propanoate metabolism
    UC34_06780
   00650 Butanoate metabolism
    UC34_06780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UC34_06780
   00072 Synthesis and degradation of ketone bodies
    UC34_06780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UC34_06780
   00310 Lysine degradation
    UC34_06780
   00380 Tryptophan metabolism
    UC34_06780
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UC34_06780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UC34_06780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UC34_06780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pve04147]
    UC34_06780
Enzymes [BR:pve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UC34_06780
Exosome [BR:pve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UC34_06780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJP56773
UniProt: A0A0C5JP63
Position
1494763..1495965
Genome map
AA seq 400 aa AA seqDB search
MREAVVVATARTAIGKAFRGAFNDTESPWLGAHVTRAVVERSGVEPELIDDVVLGVAAQQ
GTQGYNLGRLVARAAGLPETVPGASVDRMCSSGLMAVSMVAKSIMCGELDIAVAGGVESI
SLTQNKHKNAYRARSAAVLAMDPTAYIPMIETAELVASRYGISRQAQDEYALSSQQRVAS
AQRDGLFEPEIIPADVEKQLFDKEGNPSGKSRVVLGADEGNRADTSMASLSLLKPVWKDG
EWVSKGEFITAGNSSQLSDGASACLLMSRDEANRRGLKPLGAYRGFAVAGCRADEMGIGP
VFAIPKLLKRHGLSVADIGLWELNEAFACQVIYCRDQLGIPSERLNVNGGAIAIGHPFGM
TGSRLTGHALLEGKRRGVRYVVVSMCIGGGMGAAALFEID
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagagaagctgtcgttgtcgccactgcacgcaccgccatcggaaaggccttccgtggg
gcatttaacgacacggagtccccatggctgggcgctcacgtgacgcgcgccgtcgttgag
cgcagtggcgtggagcccgaacttatcgacgacgttgtccttggggtcgcagcacagcag
ggcacacagggatacaacctcggtcgtctggtcgcgcgagccgccggcctgcccgagacg
gttccgggagcgtcggtggatcgtatgtgttcttcgggactgatggccgtctcgatggtt
gccaagagcatcatgtgcggcgagctcgatattgcggtggccggtggcgtggaatcgatt
tcgctcacgcagaacaagcataagaacgcctaccgcgcacgatcggccgccgtgctggcg
atggatcccaccgcctatatcccgatgatcgaaacggctgaactcgtcgcgagccgctac
gggatttcccgtcaggcgcaggacgaatacgcactatcgagtcagcagcgcgtcgcatcg
gcgcagcgagacggtttgttcgaaccggagatcatccctgccgacgtcgagaagcaattg
ttcgacaaggaaggcaatccgagcggaaagtcgagagtggttctcggcgcggatgaaggt
aatcgtgcagacacgtcgatggcgtccctttcactgctcaagccggtgtggaaggacggc
gagtgggtcagcaaaggcgaattcattacggcgggcaattcaagtcagctctccgacggc
gcgtcggcatgcctgctgatgagccgcgacgaagcgaatcgccgcgggctcaagccgctc
ggcgcctaccgcggatttgcggtcgcgggatgccgggccgacgagatgggcattggcccc
gtctttgccatcccgaagcttctgaaacgtcatggtctgagcgttgcagacattgggctc
tgggagctcaacgaggctttcgcatgccaggtgatctattgccgcgaccaactgggaatt
ccttcggagcggcttaacgtcaacggcggcgcgatcgccatcggccatccctttggcatg
acggggagccgactgaccggccatgcactgcttgagggaaagcgccgtggtgtccggtac
gtggtcgtttcgatgtgcatcggcggtggcatgggcgctgcggcattgttcgaaatcgac
tga

DBGET integrated database retrieval system