KEGG   Pandoraea vervacti: UC34_08045Help
Entry
UC34_08045        CDS       T03688                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pve  Pandoraea vervacti
Pathway
pve00740  Riboflavin metabolism
pve00790  Folate biosynthesis
pve01100  Metabolic pathways
pve01110  Biosynthesis of secondary metabolites
pve02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    UC34_08045
   00790 Folate biosynthesis
    UC34_08045
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    UC34_08045
Enzymes [BR:pve01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     UC34_08045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AJP59548
UniProt: A0A0C5JWC2
Position
1781786..1782445
Genome map
AA seq 219 aa AA seqDB search
MKSPGTASATLNCDAGECVELVATATLPTRYGTFTSHAFRVKDSSNEHLALVMGDVTGAS
GVDLPPLVRLHSECLTGDVFGSYRCDCGEQLDAGMRKIAEEGRGVMLYLRGHEGRGIGLS
NKIRAYLLQEQGRDTVEANLDLGLPDDAREYDSAAAILRILGVGSVRLMSNNPKKFDTLI
KHGIPVSERVALDIPMREENERYIRTKQVKFGHYFEENE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccctggtactgcctctgccacgctcaactgcgacgcaggcgaatgcgtcgag
cttgttgctacggcaacgctgcccacccgctatggcacctttacctcccacgcgtttcgc
gtcaaagacagcagcaacgagcatctggcgttggtgatgggcgacgtgacgggcgcgagc
ggtgtcgatctgccgccgctggtgcgcctgcattcggaatgcctgacgggggacgtgttc
ggctcctaccgctgcgactgcggtgagcaactcgacgccggcatgcgcaagattgccgaa
gaaggccgtggcgtgatgctgtatctgcgcggtcatgaggggcgcggcatcggcctgagc
aacaagattcgtgcgtatttgctgcaagagcagggccgcgatacggtcgaggcgaacctc
gatctcggcttgcccgacgacgcccgcgaatacgattccgccgccgccatcctgcgcatt
ctgggggtgggttcggtacgcctcatgagcaacaatccgaagaagttcgatacgctcatc
aagcacggcatccccgtgagcgagcgcgtggcgctcgatattccgatgcgcgaagagaac
gaacgctatatccggaccaagcaggtcaagttcgggcactacttcgaagagaacgagtaa

DBGET integrated database retrieval system