KEGG   Pandoraea vervacti: UC34_15895Help
Entry
UC34_15895        CDS       T03688                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pve  Pandoraea vervacti
Pathway
pve00020  Citrate cycle (TCA cycle)
pve00620  Pyruvate metabolism
pve00650  Butanoate metabolism
pve01100  Metabolic pathways
pve01110  Biosynthesis of secondary metabolites
pve01120  Microbial metabolism in diverse environments
pve01130  Biosynthesis of antibiotics
pve01200  Carbon metabolism
Module
pve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UC34_15895
   00620 Pyruvate metabolism
    UC34_15895
   00650 Butanoate metabolism
    UC34_15895
Enzymes [BR:pve01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     UC34_15895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF CoA_trans LUD_dom
Motif
Other DBs
NCBI-ProteinID: AJP58050
UniProt: A0A0C5K0D7
Position
3642335..3643831
Genome map
AA seq 498 aa AA seqDB search
MYEDRIRLASLRDRVMSADDAARLVSDGMVVGMSGFTRAGDAKDMPIALARRAKASPMKI
TLITGASLGHDSDKTLTQAGVLAKRLPFQVDTTLRGAINRGEVMFVDQHLSETVEFLRTG
QFGKLDVAVIEAVAITEDGGLVPSSSVGNSASFAILAEKVIVEINLAQPLAFEGMHDIWI
PGQRPHRGPLPIVDVRDRVGTNVVKIAPEKIAAIVITQTPDSASNALPPDADTQRIAGHL
IEFFQHEVSRGRLPRALPAIQSGIGTIANAVLTGFIDSPFEDLTMYSEVLQDSTFDLMDA
GKMVFASGSSITVSQAVQDRVFKHLERYRDKLVLRPQEVSNHPEVIRRLGLVALNTALEV
DIYGNVNSTHVGGTHMMNGIGGSGDFARNARMAIFATKSVAKDGKISSIVPMVPHVDHNE
HDVDIIVTEQGLADLRTLAPRERVNLVIDNCAHPSYRDVLREYYRDAQRYGGHTPHALER
AFDLHVNLRERGSMLLGK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagaccgcattcgcctggcgtcgctgcgcgaccgggtgatgagcgctgacgac
gccgccaggctcgtgagcgacggcatggtggtcggtatgagcggattcacccgcgccggc
gacgccaaggacatgccgattgcattggccaggcgcgcgaaagccagcccgatgaaaatc
acgctgattaccggggcatcgctggggcacgactccgacaagaccctcacgcaagccggc
gtgctcgccaagcgcttgccgttccaggtcgataccacgttgcgcggcgcgatcaatcgc
ggcgaagtcatgttcgtcgaccagcacctctccgagacagtcgaattcctgcgcaccggc
cagttcggtaagctggatgtggccgtgatcgaggcggtcgccatcacggaagacggcggc
ctcgtgccaagctcgtcggtcggcaattcggcgagcttcgcgatcctcgccgaaaaggtg
atcgtggagatcaacctcgcgcagcccctcgctttcgagggcatgcacgacatctggatt
ccggggcaacgcccgcaccgcgggccgctgccgatcgtcgacgtgcgcgaccgtgtcggc
acgaacgtggtgaagattgcgccggagaagatcgcggccatcgtcattacccaaacgccg
gacagcgcgtccaacgcgctgccgccggacgccgacacgcaacgcattgcggggcatctg
atcgagttcttccagcacgaagtctcgcgcggccgactgccgcgcgcgctgcccgcgatt
cagtcgggcatcggcaccatcgccaacgccgtgctcacgggcttcatcgattcgccgttc
gaagacctgacgatgtactcggaagtccttcaggactcgaccttcgatctgatggacgcc
ggcaagatggtgttcgcctcgggctcgtcgatcaccgtatcgcaggccgtacaggaccgc
gtattcaagcatctggagcgttatcgcgacaagttggtgctgcgtccgcaggaagtcagc
aaccatccggaagtcatccggcgtttggggctcgttgcgctgaacaccgcgcttgaggtc
gacatctacggcaacgtgaattcgacgcacgtcggcggcacgcacatgatgaacggcatt
ggcggatcgggcgacttcgcccgcaacgcccgcatggcgatcttcgccaccaagtccgtc
gcgaaggacggcaagatttcgagcatcgtgccgatggtgccgcacgtcgaccacaacgag
cacgacgtcgacatcatcgtgaccgaacaggggctggccgatctgcgcacgcttgcgccg
cgcgagcgggtgaatctcgtcatcgacaactgcgcacatccgagctaccgcgacgtgctg
cgcgagtactaccgtgacgcgcagcgctacggcggtcacacgccgcatgcgctggagcgc
gcattcgacctgcacgtcaatttgcgcgagcgcggctcgatgctgttgggtaagtga

DBGET integrated database retrieval system