KEGG   Pandoraea vervacti: UC34_17875Help
Entry
UC34_17875        CDS       T03688                                 

Definition
(GenBank) tryptophan 2,3-dioxygenase
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
pve  Pandoraea vervacti
Pathway
pve00380  Tryptophan metabolism
pve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    UC34_17875
Enzymes [BR:pve01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     UC34_17875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_dioxygenase YfdX
Motif
Other DBs
NCBI-ProteinID: AJP59879
UniProt: A0A0C5K7D6
Position
4117192..4118175
Genome map
AA seq 327 aa AA seqDB search
MSKTSPTSSNTSLPGGESATPAQGGCPFGHRSDDTPGVPGGAPAAQETSATSANATQWHD
AKLDFSKSMSYGDYLSLDPILNAQHPRSTDHNEMLFIIQHQTSELWMKLALYELQAARTA
VHNDELPPAFKMLARVSRILEQLVQAWSVLATMTPSEYSSMRPSLGSSSGFQSYQYRILE
FMLGNKNAAMLAPHSHRPDLYQQVEAALKAPSFYDEVVRLLARRGFAIAPQRLERDWTKP
TPHDKTVEAAWLEVYRNPSQYWELYEMAEELVDLEDAFRQWRFRHVTTVERIIGFKQGTG
GTNGAPYLRKMLDVVLFPELWHVRTLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagacatcccccacgtcctccaacacctcgctgccgggcggcgagtccgccacg
cccgcacagggtgggtgcccgttcggtcatcgcagcgacgacacgcccggggtaccgggc
ggggcgccggcagcccaggagacttctgcgacgtcggccaacgcgacacaatggcatgac
gccaagctcgatttctcgaagagcatgagctatggcgactacctgtcgctcgatccgatt
ctgaacgcgcaacatccgcgctcgaccgatcacaacgagatgctgttcatcattcagcat
cagacgagcgaactgtggatgaagctggccttgtacgagttgcaggccgcacgcacggca
gtgcacaacgacgaactgccgcccgcgttcaagatgctcgcacgcgtatcgcgcattctc
gaacaactggtgcaggcgtggagtgtgctcgcaacgatgacgccgtcggagtattcgtcg
atgcgtccgtcgctgggcagctcgtcgggttttcagtcgtatcagtaccgcattctggag
ttcatgctgggcaacaagaatgcggcgatgctcgcgccccattcgcatcgtcccgatctg
taccagcaggtcgaagcggcgctcaaggcgccctcgttctacgacgaagtggtccgcctt
ctcgcgcgccgcggttttgcgatcgcaccgcaacgcctggagcgcgactggacgaagccg
acgccgcacgacaagacggtggaggcggcctggctggaggtgtaccgcaacccgtcgcag
tactgggagctttatgagatggccgaagaactggtcgatctcgaagacgccttccgtcaa
tggcgtttccgtcacgtgacgaccgtcgagcgcatcatcggcttcaagcagggcacgggc
ggcacgaacggtgcgccttatctgcgcaagatgctcgatgtcgtgttgttcccggagttg
tggcacgtgcggacgttgctgtga

DBGET integrated database retrieval system