KEGG   Pandoraea vervacti: UC34_22295Help
Entry
UC34_22295        CDS       T03688                                 

Definition
(GenBank) L-threonine dehydrogenase
  KO
K13954  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pve  Pandoraea vervacti
Pathway
pve00010  Glycolysis / Gluconeogenesis
pve00071  Fatty acid degradation
pve00350  Tyrosine metabolism
pve00625  Chloroalkane and chloroalkene degradation
pve00626  Naphthalene degradation
pve01100  Metabolic pathways
pve01110  Biosynthesis of secondary metabolites
pve01120  Microbial metabolism in diverse environments
pve01130  Biosynthesis of antibiotics
pve01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UC34_22295
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UC34_22295
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UC34_22295
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UC34_22295
   00626 Naphthalene degradation
    UC34_22295
Enzymes [BR:pve01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UC34_22295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AJP58930
UniProt: A0A0C5K2H1
Position
5113373..5114521
Genome map
AA seq 382 aa AA seqDB search
MSTTFFIPAVNMMGIGSLDEAIAALRQYHFRRALIVTDAGLAKAGVAEKVTRLLAQQDIQ
SVVFDGAKPNPTVANVEAGLAILRQSDCDFVISLGGGSPHDCAKGIALCATNGGHISDYE
GVDQSKKPQLPLVAINTTAGTASEMTRFCIITDEKRHVKMAIVDRNVTPLLSVNDPALMA
AMPKGLTAATGMDALTHATEAYVSTAATPITDACALKAVTLISQNLRRAVSHGDDMTARE
NMAYAQFLAGMAFNNASLGYVHAMAHQLGGFYDLPHGVCNAVLLPHVEEFNASTSAGRLK
DIAQAMGEKVEGLSDEEGAKVAIAAIRRLSKDIGIPSGLAELGAKEADVPTLAANAMQDA
CGLTNPRRAEQAEIEAIFRRAF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgactttcttcatccccgccgtcaacatgatgggcattggcagtctcgacgaa
gcgattgccgccctgcgtcaataccatttccgccgcgcgctgatcgtgaccgacgcggga
cttgccaaggcaggtgtcgccgagaaggtgaccaggctgctggcgcagcaagacattcaa
tcggtagtgttcgacggcgccaagccgaacccgacggtggccaacgtcgaagcgggcctc
gcaatcctcaggcaaagcgactgcgacttcgtgatttccctcggtggcggatctccgcat
gactgcgcgaagggcattgccttgtgtgcgaccaacggcggtcacatctccgattacgaa
ggcgtcgatcagtcgaagaagccgcaattgccgctcgtcgccatcaacacgacggccggc
accgcgagcgaaatgacgcgtttttgcatcatcacggacgaaaaacgtcatgtgaagatg
gccatcgtcgaccggaacgtcacgccgttgctgtcggtcaacgatccggcactcatggct
gccatgccgaagggcctgaccgccgcgaccggcatggacgccctcacgcacgccaccgaa
gcgtatgtgtcgacggcggcgacgcccatcaccgatgcgtgcgcgctcaaggcggtaacg
ctgatctcgcagaacctgcgtcgggcggtttcgcatggcgacgacatgacggcgcgcgag
aacatggcgtatgcgcaattcctggcgggcatggcgttcaacaacgcatcgctgggttac
gtccatgccatggcgcatcagctcggcgggttctatgacttgccgcacggtgtgtgcaat
gccgtcctgctgccgcatgtcgaggagttcaacgcaagcacgagtgccggacgcctgaag
gacattgcacaggcgatgggcgagaaggtcgagggcttgagcgacgaggaaggcgcaaag
gtcgcgattgcggcgatccgccggttgtcgaaggatatcggtattccgtcgggactggcc
gaactgggtgcgaaggaagccgacgtgcccacgcttgcggcgaacgcgatgcaggacgcg
tgtggcctcacgaacccgcgccgcgccgaacaggcggaaatcgaagcgattttccgtcgg
gcgttttga

DBGET integrated database retrieval system