KEGG   Proteus vulgaris: CRN77_17065Help
Entry
CRN77_17065       CDS       T05486                                 

Definition
(GenBank) dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pvg  Proteus vulgaris
Pathway
pvg00020  Citrate cycle (TCA cycle)
pvg00310  Lysine degradation
pvg00380  Tryptophan metabolism
pvg01100  Metabolic pathways
pvg01110  Biosynthesis of secondary metabolites
pvg01120  Microbial metabolism in diverse environments
pvg01130  Biosynthesis of antibiotics
pvg01200  Carbon metabolism
Module
pvg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pvg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CRN77_17065
  09105 Amino acid metabolism
   00310 Lysine degradation
    CRN77_17065
   00380 Tryptophan metabolism
    CRN77_17065
Enzymes [BR:pvg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CRN77_17065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: ATN01345
UniProt: A0A292CCF1
Position
complement(3714875..3716080)
Genome map
AA seq 401 aa AA seqDB search
MSSVDILVPDLPESVADASVATWHKKPGDSIQRDEVLVEIETDKVVLEVPASEAGVLESI
LEEEGATVGSRQLLGRIRLGDSTGIPADVKPAQDSTPAQRQSADIAEKGNNDALSPTARR
LVAEHDINPADVKGSGVGGRLTRQDIEGHVANKSTTQPVAEVPQALLSHRSEKRVPMTRL
RKRVAERLLEAKNTTAMLTTFNEINMQPIKDLRAQYGEAFEKRHGVRLGFMSFYIKAVVE
ALKRYPEVNASIDGTDVVYHNYFDISIAVSTPRGLVTPVLRDADAMSMADIEKNIKALAV
KGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGQVVI
LPMMYLALSYDHRLIDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtagatattctagtaccggatctccctgaatcagttgctgacgcatcggtc
gcaacttggcataaaaaacctggtgatagcattcaacgcgatgaagtgctggttgaaatc
gaaacagataaagttgttttagaagtacctgcaagtgaagcaggtgttttagaaagtatt
cttgaagaagaaggcgctactgttggttcacgccaattactaggtcgcattcgtttaggt
gatagcacaggcattccagctgatgtgaaacctgctcaagatagcactccagcacagcgt
caaagtgctgatattgctgaaaaaggcaataacgatgcattaagtccaactgcgcgtcgt
ttagtggctgaacacgatattaaccctgcggatgtgaaaggcagtggtgtaggcggacgt
ttaactcgccaagatatcgaaggtcatgttgcgaataaatcaactacacaaccggtagca
gaagttcctcaagcactgttatctcaccgtagcgaaaaacgtgtaccaatgacacgttta
cgtaagcgtgtagcagagcgcttgctagaagcgaaaaacaccactgcaatgttgacaacg
tttaacgaaatcaacatgcagccaatcaaagatttacgtgctcagtatggtgaagcattc
gaaaaacgccacggtgtacgtttaggctttatgtctttctacattaaagcggttgttgaa
gcactgaaacgctatccagaagtgaatgcttctattgatggcactgatgtggtttatcac
aactacttcgatatcagtattgcagtatcaacacctcgtggtctggtaacgccagtatta
cgtgatgcagatgctatgagcatggcggatattgagaaaaatatcaaagcgttagctgta
aaaggtcgtgacggtaagttaactgttgaagacttaacaggtggtaacttcactatcaca
aatggtggtgttttcggttcattaatgtcaactccgattatcaacccaccgcaaagtgcc
attttagggatgcatgcaattaaagatcgcccaatggcagtagacggtcaggttgttatt
ctaccaatgatgtatctggctctgtcttatgaccaccgtttaattgatggtcgtgagtct
gtcggtttcttagtaaccgttaaagagatgctagaagatccagctcgtttattactggat
gtatag

DBGET integrated database retrieval system