KEGG   Chlorobium phaeovibrioides: Cvib_0628Help
Entry
Cvib_0628         CDS       T00499                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00520  Amino sugar and nucleotide sugar metabolism
pvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cvib_0628
Enzymes [BR:pvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     Cvib_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABP36647
UniProt: A4SDT8
Position
731174..732121
Genome map
AA seq 315 aa AA seqDB search
MSKKVLVTGGAGFLGSHLCERLLAEGHDVLCVDNFFTGTKQNILHLMGNPRFELMRHDVT
FPLYVEVDEIYNLACPASPIHYQFDPVQTTKTSVHGAINMLGLAKRVKARILQASTSEVY
GDPEVHPQHEGYWGKVNPIGIRSCYDEGKRCAETLFFDYYRQHKLDIKVVRIFNTYGPRM
HPNDGRVVSNFIVQALKGEDITIYGDGTQTRSFCYVDDMVEAFLLMMLTEVGFTGPVNVG
NPGEYSMLELAEKTLTLVGGKSKIVYQPLPPDDPRQRKPDITIAESKLGWAPTVPLEEGL
ERTIGYFKEHLFGKA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaagtgttagtaaccggcggtgccggattccttggatcccatttatgcgag
cgattgcttgcagaggggcacgatgtgctttgtgtcgataacttcttcaccggcacgaag
cagaatatcctgcatttgatgggaaatccacgcttcgagctcatgcggcatgatgtcacc
tttccactctatgtggaggttgatgagatatacaacctagcctgtcccgccagcccgatc
cactaccagttcgatccggtacagaccaccaagacaagcgtgcatggagccatcaatatg
ctggggcttgccaaacgtgtcaaggcgcgtatcctccaggcatcgaccagtgaagtgtac
ggcgacccggaagtccacccgcagcatgaggggtattggggtaaagtaaaccctatcggt
atccgcagctgctacgatgaaggcaagcgatgcgctgagacactcttttttgattattac
cgccagcataagctcgacatcaaggttgtcaggatattcaacacctacgggccgaggatg
catcctaatgacgggcgtgtggtcagcaacttcattgttcaggcactcaagggggaagac
atcactatttacggggacggaacacagacaagaagcttctgctatgtcgatgatatggtg
gaagcgtttcttctcatgatgctgacagaggtaggatttactgggccagtcaatgtcggt
aaccctggagagtactccatgcttgagcttgcagaaaagacactcacgctcgtcgggggc
aaatcaaagattgtttatcaaccactgccgccggatgacccgcgccagagaaagccggat
attacgattgctgagtcgaaactcggatgggcaccgactgtgcctcttgaggagggactt
gagcggacgattgggtatttcaaagaacacctatttgggaaagcatag

DBGET integrated database retrieval system