KEGG   Chlorobium phaeovibrioides: Cvib_1058Help
Entry
Cvib_1058         CDS       T00499                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00860  Porphyrin and chlorophyll metabolism
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cvib_1058
Enzymes [BR:pvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cvib_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA AAA_5 Sigma54_activat MCM DUF1676 Mor
Motif
Other DBs
NCBI-ProteinID: ABP37072
UniProt: A4SF13
Position
complement(1196052..1197914)
Genome map
AA seq 620 aa AA seqDB search
MIAFTDIVGMDLAKKALMLLAIDPALGGVVIPSAVGSGKSTLARAFAGILPEGTPFVELP
LNVTEDRLIGGVDLEATLASGVRVVQHGVLSKADGGVLYVDSLSLLDSSAISHIMDAMSR
GEVLVEREGLSEVHPADFMLVGTYDPTDGEVRMGLLDRIGIIVPFTAQNDYRARKEVVNI
VTGSRDPEDVRDELRMMAGFLDAAREMLPKVGITPEQVQALIQTAISLGVEGNRVDVFTV
RAALASAALNQRSDVDDEDMKLAIKLVLIPRATRMPEREESAEDMPPPEEEPPPPDEESE
EEDDSQQPDSPDADAEEEQEETPDMIEELMMEAIETELPDNILNISLASKKKSTSGSRGE
ALNNKRGRFVRAQPGEMRSGKVALIPTLISAAPWQEARKRDQKMAGRQKTALLISKDDVK
IKRFRDKSGTLFIFMVDASGSMALNRMRQAKGAVASLLQNAYVHRDQVALISFRGKQAQV
LLPPSQSVDRAKRELDVLPTGGGTPLASALYLGWETAKQARTKGITQVMFVLITDGRGNI
GLQSSFDPNAEKPSKEELEKEIEALSLSIQADGVAATVIDTQMNYLSRGEAPKLAQHLGG
RYLYLPNAKAEQIVDAALSF
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgatagcatttaccgatattgttggaatggatctggccaagaaggcgctcatgcttctg
gccattgatccggctcttggcggtgttgtcattccctcggccgtagggtcgggcaagtca
actcttgccagagcgtttgccggtattcttcccgaggggacaccctttgtggaactgcca
ctgaatgtcactgaagatcgtctcattggaggcgtcgaccttgaagcgacccttgcttca
ggagtacgggttgttcagcacggtgtgctttcaaaagctgacgggggagtgctctatgtg
gactcgctcagcctgcttgacagctcggccatttcacacatcatggatgccatgtcgcgt
ggcgaggtgcttgttgagcgggaagggctcagtgaggtgcatcctgccgacttcatgctg
gtaggcacatacgaccccacagacggggaagtccgtatgggcttgcttgaccgcataggc
attattgttccctttaccgcacagaacgattaccgtgcccgcaaggaggtggtcaatatt
gtcaccgggagcagggaccctgaagatgtgcgtgacgaactgcggatgatggccggattt
cttgacgcagcccgagaaatgctgccgaaggtcggcattactcccgaacaggttcaggca
ctgatccagacagccatcagccttggtgttgagggaaaccgtgtggatgtgttcactgtg
cgtgccgctcttgccagcgcagcccttaaccagcgcagcgatgttgatgatgaggatatg
aagcttgcaatcaagctggttctcattccccgtgccacacgcatgccggaacgcgaggag
tcagcagaagatatgccgccgcccgaagaggagccgccgccgcctgatgaggagtcggaa
gaggaggatgattcccaacagcctgattctccggatgcagatgcagaggaggagcaggag
gagaccccggatatgattgaggagctcatgatggaggctatcgagaccgagcttcccgac
aacatcctgaacatttcgcttgcttcgaaaaagaaaagcacctcggggagccgtggtgaa
gcgctcaacaacaagcggggccgttttgtgcgtgcccagcccggtgagatgcgcagcggc
aaggttgcccttattccaacccttatttcagctgccccctggcaggaagctcgcaagcgc
gaccagaagatggccggtcgccagaaaacagcactgctcatcagcaaggatgatgtcaag
atcaagcggttccgcgacaagtccggtacgctcttcatcttcatggtggatgcttccggt
tcaatggcgctcaaccgcatgcgtcaggcaaagggtgctgttgccagcctccttcagaac
gcctatgtgcatcgtgaccaggttgctctcatatcattccgcggcaagcaggcccaggtg
ctgcttcccccgtcacagagcgttgaccgtgccaaacgagagcttgatgttcttcctaca
ggaggtggaacgccattggcctcagctctctaccttggttgggaaaccgcaaagcaggcc
cgtaccaaaggtatcacgcaggttatgttcgtgctgatcactgatggccggggtaatatc
ggtctccagtcatcttttgaccccaatgctgaaaagccttcaaaagaagagctggaaaag
gagattgaagccctgtcgctatccattcaggctgacggcgttgcggctacagtgattgat
acccagatgaactatctctcccggggtgaagcacccaagcttgcccagcatcttggtggc
cgttatctctacctgcccaatgccaaggcagagcagattgttgatgctgcactcagcttt
taa

DBGET integrated database retrieval system