KEGG   Chlorobium phaeovibrioides: Cvib_1059Help
Entry
Cvib_1059         CDS       T00499                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00860  Porphyrin and chlorophyll metabolism
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cvib_1059
Enzymes [BR:pvi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cvib_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_16 MCM Sigma54_activat AAA_22 AAA_33 AAA AAA_29 DUF815 AAA_18 GTP_EFTU AAA_30 MMR_HSR1 RNA_helicase ABC_tran
Motif
Other DBs
NCBI-ProteinID: ABP37073
UniProt: A4SF14
Position
complement(1197915..1199096)
Genome map
AA seq 393 aa AA seqDB search
MTQTESSARKPAAKKPVARKTTAAKAGSSVAKAAPAKAAAASAKKKSGLAFPFTAIVGQE
EMKLSLILNIIDPRIGGVLVMGHRGTGKSTTVRALAEVLPMIDRVKDDIYNRTTEQYLEG
EADKKGAVKIDPASVKLEKIPVPVVDLPLGATEDRVCGTIDIEQALTSGVKAFEPGLLAQ
ANRGFLYIDEVNLLDDHLVDVLLDVAASGKNVVEREGISIRHPARFVLVGSGNPEEGELR
PQLLDRFGLHARIITINDVAKRVDIVKRRRDFDEDPEAFMKKYNNEQVKLQKKIQKAKTL
LPSVSMSDEVLTDIAKLCMNLGIDGHRGELTITRTAHAHAAFMGQKEVTMKHVKDVAGLC
LRHRLRKDPLETLDAGEKIERELAKVLGEAEAV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgactcagactgaatcatctgccagaaaacctgctgcaaagaaaccggtcgccagaaaa
acaacagcagcaaaggctggttcaagcgtggcaaaggcggctcctgccaaggcagcagcg
gcatctgccaaaaagaaatccggtcttgctttcccttttaccgctattgtcggtcaggag
gaaatgaagctcagtctgattctcaacatcattgatccccgtatcggcggcgttcttgtc
atggggcaccgcggaacaggaaaaagtaccacggtcagggcacttgcagaggtgcttcct
atgattgaccgcgtgaaggatgatatttataaccgtaccaccgagcagtatctggaaggc
gaggcggataaaaaaggtgctgtgaagattgatccggcatctgtcaagctggaaaaaatt
ccagttcctgtggttgaccttccccttggcgcaaccgaggatcgtgtttgcggcaccatt
gacattgaacaggctctgacgagcggcgtgaaggcttttgagccgggacttcttgctcag
gccaacaggggattcctctatattgacgaggtcaaccttcttgatgaccatcttgttgat
gtgcttcttgatgtggctgccagcggaaagaatgtggttgagcgcgagggtatcagcatc
cgccacccggcccgtttcgttctggtcggttcaggaaaccctgaagagggtgagcttcgc
ccgcagctgcttgaccgtttcggtcttcatgcacgcatcatcaccatcaatgatgtggca
aagcgcgttgacatcgtcaaacgccgtcgcgatttcgatgaggatcctgaagcgttcatg
aaaaagtataataacgaacaggtcaagctccagaagaaaattcagaaggccaagacgctg
cttccttccgtgagcatgagtgatgaggtgctgaccgatattgcaaaactctgcatgaac
ctcggtattgatggccatcgcggtgaattgaccattaccaggactgcgcatgcacatgct
gcgttcatgggccagaaagaggtgaccatgaagcatgtcaaggatgttgcgggcctgtgc
ctgcgccaccgtctgcggaaggatccgcttgaaacgcttgatgccggtgaaaaaattgaa
cgcgaacttgccaaagtccttggagaagcagaagcagtataa

DBGET integrated database retrieval system