KEGG   Chlorobium phaeovibrioides: Cvib_1112Help
Entry
Cvib_1112         CDS       T00499                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K18682  ribonucrease Y [EC:3.1.-.-]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Cvib_1112
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pvi03019]
    Cvib_1112
Enzymes [BR:pvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Cvib_1112
Messenger RNA biogenesis [BR:pvi03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Cvib_1112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3552 HD KH_1 HDOD KH_4 DEP KH_2 XRN_M
Motif
Other DBs
NCBI-ProteinID: ABP37126
UniProt: A4SF67
Position
complement(1251717..1253291)
Genome map
AA seq 524 aa AA seqDB search
MGIVINLFLLVPASIVFFAAGFFLGRFFLERLGTTKVLEAEERAVQIVQEAQKEANEYKD
LKVTEVNQEWKKKRREFDQEVVIKNNKFNQMQKQVQQREGQLKKQAQDNRDMERRLQDQR
KENEQVQESVTLRAAELERIISEQNERLESISGLQSEDARQMLIDNMISKAREEATETIH
QIHEEAEQEAERLAEKTLLTAIQRITFEQATENALSVVHIQTDELKGRIIGREGRNIKAF
ENATGVDIIVDDTPEVVILSCFDPLRRELAKLTLQKLLSEGVIHPVAIEKAYEDASKEIA
DVIMSAGEDALSSLQLPDMPAEVVKTVGKMKFHTVYGQNLLQHSREVAMLAGVMATELKL
DARLAKRAGLLHDIGLVLPATDEPHAISGRNFLKRFNESGVVLNAIAAHHGEVEKESPIA
ELVDAANVISLSRPGARGAMTADGNVKRLESLEEIAKGFPGVIKTYALQAGREIRVIVEG
DNVSDSQADVLAHDIAHKIESEAQYPGQIKVSIVREKRSVAYAK
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgtcatcaacctgtttttacttgttcccgcatcgattgttttttttgcggca
ggtttttttctcggtcgtttttttcttgaacggcttggcacaacaaaggttcttgaagca
gaagagcgtgcagtgcagatagttcaggaggctcagaaagaggctaatgagtacaaggac
ctcaaggtcacggaagtcaatcaggagtggaaaaagaagcgtcgtgaattcgatcaggaa
gtggtcatcaagaacaacaagttcaaccagatgcagaagcaggttcagcagcgcgagggc
cagcttaaaaaacaggctcaggacaatcgcgacatggagcgcaggcttcaggaccagcga
aaggagaacgagcaggttcaggagagcgtgacgcttcgtgccgcagagctggaaaggatt
atttctgagcagaacgaacggctggagagcatcagcggcctgcagtcggaagacgcccgt
cagatgcttatcgataatatgatttcgaaagcgcgtgaggaggcgacggaaaccattcac
cagattcatgaagaggccgaacaggaggctgaacggcttgctgaaaaaactctgcttaca
gccattcagagaatcacctttgagcaggcgactgaaaatgccctctccgtcgtacacatc
cagaccgatgagctcaagggacgcattatcggcagggaaggccgcaacatcaaggcattt
gagaacgcaaccggggtggacatcattgttgatgatacacccgaagtggtcattctctcc
tgttttgatccccttcgccgcgagcttgccaagctgacactccagaagctgctttcagaa
ggtgtgattcaccctgtggccattgagaaagcctatgaggatgccagcaaggagattgcc
gatgtcatcatgagtgccggtgaggatgcgctttcatcgctgcagcttcccgacatgcct
gccgaggttgtcaagacggtcggaaaaatgaaattccatacggtctacggccagaacctt
ctgcagcacagccgcgaagttgctatgcttgccggcgtcatggctacggagctgaagctc
gacgcccgtctcgcaaaacgcgcaggcctgttgcatgatatcggcctggttctgccggca
accgatgagccgcatgccatatcggggcgcaacttcctcaagcgcttcaatgaatcgggg
gtcgtgctcaatgctattgccgcccatcatggcgaggttgaaaaagagtcccccatcgcc
gagcttgtcgatgcggccaatgtcatctccctttcacggcccggtgccagaggtgccatg
acggcagatggcaatgtgaagcggcttgagagccttgaagagatagcaaaaggattcccc
ggagtcattaaaacctatgctctacaggcaggacgcgaaatccgtgtgattgtggagggc
gacaatgtcagcgattcacaggcagatgtgctcgctcacgacattgcccataaaattgag
tctgaagctcagtatcccgggcagatcaaggtttcgattgttcgcgaaaagcgctcagtt
gcctatgccaaatag

DBGET integrated database retrieval system