KEGG   Chlorobium phaeovibrioides: Cvib_1275Help
Entry
Cvib_1275         CDS       T00499                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00010  Glycolysis / Gluconeogenesis
pvi00051  Fructose and mannose metabolism
pvi00562  Inositol phosphate metabolism
pvi01100  Metabolic pathways
pvi01110  Biosynthesis of secondary metabolites
pvi01120  Microbial metabolism in diverse environments
pvi01130  Biosynthesis of antibiotics
pvi01200  Carbon metabolism
pvi01230  Biosynthesis of amino acids
Module
pvi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pvi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cvib_1275
   00051 Fructose and mannose metabolism
    Cvib_1275
   00562 Inositol phosphate metabolism
    Cvib_1275
Enzymes [BR:pvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cvib_1275
Exosome [BR:pvi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cvib_1275
  Exosomal proteins of bladder cancer cells
   Cvib_1275
  Exosomal proteins of melanoma cells
   Cvib_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABP37287
UniProt: A4SFM8
Position
complement(1428484..1429236)
Genome map
AA seq 250 aa AA seqDB search
MRRKIVVGNWKMNKTVAESTELASAVVAALGSDCSACEAGIAPTYPALDSVGRTIKGSEV
LLVAQNCHYEDDGAFTGEVSTGMLNALGCSYVIIGHSERRQYFGETDATVNLRIKKVLAA
GMKAILCVGETLEERESGAFEAVVSTQVTGGLQGVVDISDIVIAYEPVWAIGTGRTASSE
QAQEVHKIIRNKVAELYGAPAADAVRIQYGGSVKPSNAAELFAMPDIDGGLIGGAALKAE
DFAAIVKAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaaaaattgttgtcggaaactggaaaatgaacaagacggtcgctgaatcgacc
gaacttgcctcggcagttgttgctgcgcttggaagcgactgttcagcatgcgaggccggt
attgcaccgacctatcctgcacttgactcagttggccgcaccataaagggaagtgaagtt
cttcttgtggcacagaactgccattatgaagatgacggggcatttaccggagaggtttca
accggcatgctcaacgctcttggatgctcttatgtcatcattggccattctgagcgccgt
cagtatttcggtgaaacagatgcaaccgtcaaccttcgcatcaaaaaagttcttgcagca
ggcatgaaagccattctctgtgtcggtgaaacccttgaagaacgggaatccggcgcgttt
gaggctgttgtttccacacaggtgaccggcggactgcagggcgttgttgacatcagcgac
attgtgattgcctatgagcctgtatgggccatcggtaccggcaggacagccagttcagag
caggctcaggaagtccataaaattattcgcaacaaggtcgcagaactctatggagcccct
gctgcagatgctgtgcgcattcagtatggcggaagcgtcaaaccttccaatgcggcagaa
ctctttgccatgcccgacattgacggcggcctcattggaggcgcagccctcaaggcagaa
gatttcgcggctatcgtcaaagctgcctgctga

DBGET integrated database retrieval system