KEGG   Chlorobium phaeovibrioides: Cvib_1568Help
Entry
Cvib_1568         CDS       T00499                                 

Definition
(GenBank) Phosphopantothenate-cysteine ligase / Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi00770  Pantothenate and CoA biosynthesis
pvi01100  Metabolic pathways
Module
pvi_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Cvib_1568
Enzymes [BR:pvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Cvib_1568
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Cvib_1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC
Motif
Other DBs
NCBI-ProteinID: ABP37578
UniProt: A4SGG9
Position
1743036..1744274
Genome map
AA seq 412 aa AA seqDB search
MLKGKRIVLGVCGGIAAYKTPHLVRLLKKAGAEVRVALTEAGGRFVSELSLATVSGEPVL
GNMFPATDTPGVDFTTHISLGEWADALVIAPATANTLAKLSAGLCDDMLTACFITLRPNR
PVLIFPAMDGQMFLSASVQRNVLTLSEQGCHVFSPESGELASGLCGLGRMAEPEEISAQL
HCAFASTPHSSSFSGLRVVVTAGPTREKIDGVRFISNYSSGKMGFAVAREAAGRGAKVTL
ITGPVSLEAPPGIRRIDVQSAREMNEAAESLFSETDIFIGAAAVADYRPAEPIEGKVKKG
DSEMEMRLVQNPDILAGFGAQKSARQLAIGFALEEAGGIEHARTKLEAKNLDLIAFNTFN
GTDSGFEVDTNILTLIGRGDETVALTKLTKEAAAGKLLDAVERLLPRKAKQA
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagggtaaacggattgttctgggggtgtgcggcgggattgctgcgtataaaaca
ccgcatcttgtgcggcttctgaagaaggcgggggcggaggttcgggtagcgttgacggag
gcggggggaaggttcgtcagcgagctttcgctggctactgtgtcgggggagcctgttctt
gggaacatgttcccggctactgacacacccggagttgattttacgacgcatatttcactg
ggcgagtgggctgatgcactggtgattgcgccggctacggccaatactctggcgaagctc
tcggcggggctttgcgacgatatgctgacggcttgtttcattacccttcgcccgaaccgg
ccggtgctgatttttccggcaatggatggccagatgttcctctcggcctcggtgcagcgc
aatgttttgacactctcggaacagggttgccatgtattctcccctgaaagcggcgaactg
gcttcgggactgtgcggcttaggcagaatggctgagccggaggaaatttcagcacagctt
cattgtgcgtttgcgtctactcctcatagctcttccttttctggccttcgggttgtggtt
acggcagggccaaccagggagaagattgacggggtccggtttatttcaaattattcgtcg
ggaaagatgggcttcgcagttgcccgtgaagctgccggtagaggagcgaaggtgacgctg
attaccgggcctgtgagccttgaggctcctccgggcattcggcgcatcgatgtacagagc
gcacgggagatgaacgaggcggctgagagcctgttttcagagaccgatattttcattggg
gcggcggctgttgccgattaccgtccggccgaacctattgaaggcaaggttaaaaaaggg
gactctgagatggagatgcggttggtgcaaaaccccgatattcttgccgggttcggagca
cagaagtcagcgcggcagctggccattggctttgctcttgaggaggcgggcggcattgag
catgcacgaacaaagctggaagcaaaaaatcttgacctgattgccttcaataccttcaac
gggaccgattcgggttttgaggtggatacaaatatccttactctgataggaagaggggac
gaaacagtggcccttacaaaactgacgaaagaggctgcggcaggaaagctccttgatgca
gtggaacggcttctgccgcgaaaggcaaagcaggcatga

DBGET integrated database retrieval system