KEGG   Chlorobium phaeovibrioides: Cvib_1771Help
Entry
Cvib_1771         CDS       T00499                                 

Definition
(GenBank) protein translocase subunit yidC
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
pvi  Chlorobium phaeovibrioides
Pathway
pvi02024  Quorum sensing
pvi03060  Protein export
pvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Cvib_1771
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Cvib_1771
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Cvib_1771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pvi03029]
    Cvib_1771
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pvi02044]
    Cvib_1771
Mitochondrial biogenesis [BR:pvi03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Cvib_1771
Secretion system [BR:pvi02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Cvib_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 60KD_IMP YidC_periplas
Motif
Other DBs
NCBI-ProteinID: ABP37779
UniProt: A4SH20
Position
complement(1963716..1965458)
Genome map
AA seq 580 aa AA seqDB search
MDRNSVTGLALIALIMIVWLQFMSPDKKPVIRESAKKAASVEQVNVPLKPAPVSASDAFG
AFASAANGKARKMVVENDLFRATISSKGATLTSLVLKKHLDGALQPVQLVSNRADGALSL
LFLTREGRKIDTRDLYFTGGSVDTLHTVTGKESYSVRYRLNVSKNRNILITYSFTGDSYR
VGYDVQLNGFSSALAGNEYQLQWDGGLGYTEKNREDEAHNALAGAYLGGSLVKLDAAKDN
QAYREEQSGEAKWVAVRNKYFVAALIPAGPTGGFYLDGSKKAGNEFENYLASLKMEVPVS
GASLDNSFSLYMGPLDYDIVRAQKAELEKIMDFGWDWLTRPFAEYIILPVFSWMNKFIHN
YGLIIIIFAFLIKLVTYPLSLASTKSMKKMAALQPMLKELQDKYKDNPAKLQSELGRIYK
EAGVNPLGGCLPVVLQMPLLFAMFYVFRSSIELRQHGFLWAHDLSVPDSILNLGFTIPMY
GDHIALMPILMAGTVFVQQKITPTAQTNDQMKIMLYMFPAMMLLFFNNMPSGLGLYYLMF
NVFSVAQQFYINSTTTEADMPNVSIAAPARQKKKKSGGGK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaattcggtaacgggacttgctcttatagccttgatcatgatagtttggctt
cagttcatgtcgccggacaaaaaacctgttatccgcgaaagcgcaaaaaaagcggcgtct
gtggagcaggtgaatgtgcctctcaagcctgcgccagtttccgcttccgatgcattcgga
gcatttgcttcagctgcaaacgggaaggctcgaaagatggttgttgaaaacgacctgttc
cgggcaaccatctcttcaaaaggagcgaccctgacctcgctggtcctgaagaagcatctt
gatggagcccttcagccggttcagctagtcagcaaccgggcagatggtgccctttcattg
ctttttctgacaagagagggacgaaaaattgacactcgcgacctctatttcaccgggggt
tccgttgatacgcttcacacagtcacggggaaggagagctacagtgtccgataccgcctg
aatgtttcaaaaaaccggaatattctgataacctacagctttaccggcgacagttaccgg
gtcgggtatgatgtgcagctgaatggattctccagcgctcttgccggcaatgaataccag
ctgcagtgggacggaggccttggctatactgagaagaaccgcgaggatgaggctcacaac
gcacttgccggagcctatctcggtggcagcctcgtgaagctggatgcagccaaggataat
caggcataccgcgaagagcagtcgggtgaagcgaaatgggtggctgtgcgcaataaatat
tttgtagctgcgcttattcccgccgggcctacaggcgggttctatctggacggcagcaaa
aaagcgggcaacgaatttgagaattaccttgcgtcgctgaaaatggaggttcccgtatca
ggcgcctctctcgacaacagtttcagcctctatatgggccctcttgactatgatatagtc
agagcccagaaggctgaactggaaaaaatcatggatttcggctgggactggctgacacgg
ccgtttgccgagtatatcattctccctgttttcagctggatgaacaagttcatccataac
tatggtctgatcatcatcatttttgccttcctcatcaagctggtgacctatcctctgtcg
cttgcttcgaccaagtctatgaaaaaaatggctgcgctgcagcccatgctcaaagagctg
caggataagtacaaggacaatccggcaaagctgcagagcgaattgggacgcatttacaag
gaggccggtgtcaatcctctggggggatgccttcctgtggtgcttcagatgccgctgctc
ttcgccatgttttatgtgttccgttcctcaattgaactccgccagcatggatttctctgg
gcgcatgatctttctgttccggactccattctgaatcttggatttaccattccgatgtat
ggcgaccacatcgccctgatgcctatccttatggccggaacggtgtttgtgcagcagaaa
atcactccgacggcacagaccaatgatcagatgaagatcatgctctacatgttcccggcc
atgatgctgctgtttttcaataacatgccctcgggtcttggtctgtattatctgatgttc
aatgtgttcagtgttgcccagcagttctacatcaattcgaccacgactgaagccgacatg
ccgaatgtgtcgattgccgcgcccgcgcgtcagaagaagaaaaaatccggcggcggaaag
tag

DBGET integrated database retrieval system