KEGG   Proteus mirabilis CYPV1: AOB99_00225Help
Entry
AOB99_00225       CDS       T04093                                 

Gene name
rfaD
Definition
(GenBank) ADP-L-glycero-D-manno-heptose-6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00540  Lipopolysaccharide biosynthesis
pvl01100  Metabolic pathways
Module
pvl_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    AOB99_00225 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:pvl01005]
    AOB99_00225 (rfaD)
Enzymes [BR:pvl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     AOB99_00225 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:pvl01005]
 Unusual sugar
  AOB99_00225 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 adh_short KR Ldh_1_N NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ALE23934
Position
complement(43701..44639)
Genome map
AA seq 312 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNDEGYTDILVVDNLKDGTKFVNLVDLNIADYMDKEDFIASI
VAGDDFGDIDAVFHEGACSSTTEWDGKYMMDNNYQYSKELLHYCLDRQIPFLYASSAATY
GGRTDHFIEERKYEAPLNVYGYSKFLFDEYVRQILPEAQSMVCGFRYFNVYGPREGHKGS
MASVAFHLNTQVNDGQNPKLFEGSETFQRDFIYVGDVAAVNLWFWHNNVSGIYNCGTGRA
ESFQAVADAVIAYHNDKDLSVEHIEFPEKLKGRYQAFTQADLTNLRKAGYSAPFKTVAEG
VALYMQWLNQDK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgattatcgtcactggcggtgcaggttttatcggcagcaatattgttaaagcattaaat
gatgaaggttataccgatattttagtggttgataacctaaaagatggcacaaaatttgtg
aatcttgtcgatcttaatatcgctgactatatggataaagaagactttattgccagtatt
gtagccggtgatgattttggtgatattgatgccgtattccatgaaggggcatgctcttct
actaccgaatgggatggcaaatatatgatggataataactatcaatattctaaagagtta
ttgcattattgcctcgatcgccaaattcctttcttatatgcctcttctgctgccacttat
ggtggccgtactgatcattttattgaagaaagaaaatatgaagccccacttaatgtgtat
ggctactctaaattcttatttgatgaatatgtgcgccaaattttgcctgaagcacaatct
atggtgtgtggtttccgttattttaatgtgtatggcccccgtgaaggacataaaggcagt
atggccagtgtcgccttccatttaaatacacaagtcaatgacgggcaaaatcccaaatta
tttgaaggtagtgaaaccttccaacgtgactttatttatgtgggggatgtggctgcggtt
aatttatggttctggcacaacaatgtctccggtatttataattgtggtaccggccgcgca
gaatcgttccaagccgtggctgatgcagttattgcttatcataacgataaagatctctct
gttgagcatattgaattccctgagaaactcaaaggtcgttatcaagcctttacacaagct
gatctgacaaatttacgcaaagcaggctacagcgccccttttaaaacggtcgcagaaggt
gttgctctttatatgcaatggttaaatcaggataagtaa

DBGET integrated database retrieval system