KEGG   Proteus mirabilis CYPV1: AOB99_08545Help
Entry
AOB99_08545       CDS       T04093                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00740  Riboflavin metabolism
pvl00790  Folate biosynthesis
pvl01100  Metabolic pathways
pvl01110  Biosynthesis of secondary metabolites
pvl02024  Quorum sensing
Module
pvl_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    AOB99_08545
   00790 Folate biosynthesis
    AOB99_08545
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AOB99_08545
Enzymes [BR:pvl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     AOB99_08545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ALE25420
UniProt: A0A1Z1SV20
Position
1873698..1874297
Genome map
AA seq 199 aa AA seqDB search
MKLRRIAEAKLPTPFGEFLMVGFEEIATGKDHVALVFGDISGTKPVLSRIHSECLTGDAL
FSLRCDCGFQLEAALSQISKEGRGVLLYHRQEGRNIGLLNKIRAYALQDQGLDTVEANLK
LGFKADERDFTLCADMYNLLGIHEVRLLTNNPKKIEIMKEAGINVVERVPLIVGRNPSNA
HYLDTKADKMGHMLFKKAQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaagacgtatcgcagaagcaaaactccctactccttttggtgagtttttaatg
gtgggttttgaagaaattgccacaggaaaagatcatgttgccctcgtttttggtgacatt
tctggcacaaaacccgttttatcccgtattcattctgaatgtttaactggcgatgcacta
tttagcctgcgttgtgattgtggttttcagctagaagctgccctttcacaaattagcaaa
gaaggccgtggtgtattactttatcatcgccaagaaggtcgcaatattggtttacttaat
aaaatccgcgcttatgcattacaagaccaaggattagatactgtcgaagctaatctaaag
ttaggatttaaagctgatgagcgtgacttcaccctttgcgctgatatgtataatctatta
ggcatacatgaagtacgattattaaccaataatccaaagaaaatcgaaataatgaaagaa
gctgggatcaacgtggtagagcgtgttccattaatcgtaggacgtaatccaagtaatgct
cattatcttgatactaaagcggataaaatgggacatatgttatttaaaaaagcgcaataa

DBGET integrated database retrieval system