KEGG   Proteus mirabilis CYPV1: AOB99_15065Help
Entry
AOB99_15065       CDS       T04093                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
pvl  Proteus mirabilis CYPV1
Pathway
pvl00561  Glycerolipid metabolism
pvl00640  Propanoate metabolism
pvl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AOB99_15065
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    AOB99_15065
Enzymes [BR:pvl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     AOB99_15065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: ALE26595
UniProt: A0A1Z1SQU6
Position
complement(3344234..3345337)
Genome map
AA seq 367 aa AA seqDB search
MSSILPRSVTSPKKFFIGSQLLASVGNYMKDFGDNAFIISDEFFLEKVNKEALSSIKENG
LSGFVEKFNYECTEAEVDRLGKIVVENKANVIIGIGGGKTLDVSKAVAYYHHLPVILFPT
IASTDAPCTALSVLYKENGEFDKYLFLPQNPDMVIADTAIIASAPQRFFSAGVGDALATY
FEARACYQADGLNLVNQRPSRTGLGLAQLCFEILSENIDKAMDAVRHKITTQALEQTIEA
TIYLSGVGAEAGGLAAAHAVNNGMSAVASLHHVQHGEKVVFGLLTQLVLENAPQEEIDEV
IRIIKAAELPLTLEDMGMKEFIESEWRNVAKIACAEGDTMGNMPMKVTEEDVYNAMIAAN
ALAHRYK
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctatattacctcgctctgtaacatcccctaaaaaattctttattggtagtcaa
ttacttgcttctgttggtaattatatgaaagatttcggagataatgcttttattatcagc
gatgaatttttcctagaaaaagtaaataaagaagctttgtcgtcaattaaagaaaatggg
ctatctggtttcgttgaaaaatttaattacgaatgtacagaagctgaagtggatcgcttg
ggtaagattgttgttgaaaataaagcgaatgttattatcggtatcggtggtggtaaaaca
ttagacgtatctaaagcggttgcttattatcatcacctccctgttattttattcccaacg
attgcttctacagatgcaccttgtacagcactttctgttctttataaagaaaatggtgaa
tttgataaatacttattcttacctcagaaccctgatatggtgattgcggataccgcgatt
attgcttctgcaccacaacgcttcttctctgcaggtgtcggtgatgctttagccacttat
tttgaagcacgtgcttgctatcaagctgatggacttaatttagttaatcaacgtccatca
cgtacaggtttaggtctagcacaattgtgttttgaaatattgagtgaaaatattgataaa
gcaatggatgctgtgcgccataaaattaccacacaagctttagagcaaactattgaagcg
actatttatttaagtggtgtgggggctgaagcaggtggtttagcagccgctcatgcggtc
aataatggtatgtctgcagttgcttccttacatcatgtgcaacatggtgaaaaagtggta
tttggattattaacacaattagtgttagaaaatgcgccacaagaagaaattgatgaagtt
attcgtattatcaaagcggctgaattgccattaacgcttgaagatatgggaatgaaagag
tttattgaaagtgaatggcgtaatgtagcgaaaattgcttgtgcagaaggtgataccatg
ggcaatatgccgatgaaagtgactgaagaagatgtctacaacgcaatgattgcagcgaat
gcattagcgcatcgctataaataa

DBGET integrated database retrieval system