KEGG   Penaeus vannamei (Pacific white shrimp): 113804158Help
Entry
113804158         CDS       T06111                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113804158
Enzymes [BR:pvm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     113804158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 113804158
NCBI-ProteinID: XP_027210797
Position
Unknown
AA seq 251 aa AA seqDB search
MRYAKDGGLYMPEVIPKLNETEVKEWSTHSYPELVYLISRKFISEEEIPSHALKDIINGS
LKRFRTPKIIEIERLEGGLNIVELFHGTTLAFKDLALSVVGGLLDFFLKENSEHVTVLIG
TSGDTGSAAIESVRGRESIDIVVLLPHGRCTHIQELQMTTVIEDNVHVYCVDGTSDELDE
PIKRCFADEEFVAKHRLISINSINWGRIMAQVAHYFYTYYQLCSFVGQPLKVVVPTGAAG
NITGKLFSEHS
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaggtatgccaaagatggtggtctctatatgcctgaagtcatcccaaaactgaatgaa
acagaggtaaaagaatggtcaacacattcttatccagagcttgtgtatcttatttcacgc
aagttcatttcggaggaagaaattccctcgcatgctttgaaagatatcataaatggaagc
ttaaagagattccgtacaccaaagatcatcgagatagaaaggttagaaggaggcctaaac
attgtggaactctttcatgggacaaccctagccttcaaagacttggctctctctgttgta
ggaggattacttgacttcttcttgaaggaaaacagtgaacatgtcactgttctgatagga
acttcaggtgacacaggcagtgcagccatagagagtgtgagaggaagagagtccattgat
attgtggttctccttcctcatggtcgttgcactcacattcaagagctacagatgacaact
gtgatagaagataatgtacatgtttactgtgttgatggcacatctgacgagttggatgag
ccaatcaaacgttgttttgctgacgaggaatttgttgctaagcaccgattgatatccatt
aactctatcaactggggccgtatcatggctcaggttgctcactacttctacacatattat
caactctgctcctttgtaggccagcctctgaaggttgtagtgcccacaggtgcagctggc
aatataactggtaagttattctctgagcattcgtag

DBGET integrated database retrieval system