KEGG   Penaeus vannamei (Pacific white shrimp): 113808319
Entry
113808319         CDS       T06111                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvm01002]
    113808319
Enzymes [BR:pvm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     113808319
Peptidases and inhibitors [BR:pvm01002]
 Metallo peptidases
  Family M1
   113808319
SSDB
Motif
Pfam: ERAP1_C Peptidase_M1_N Peptidase_M1
Other DBs
NCBI-GeneID: 113808319
NCBI-ProteinID: XP_027215499
Position
Unknown
AA seq 941 aa
MEGPMRMSDVLTNSQPHNNYNTLNNEENSSGSPNESGFMVNKRAMYEPGAVMVCSQKRAC
CVVTLGFVAIIAVALIVAFTKPGCPEATYTGEPLPGQSIRPTSSPPTTPPTATNGELFPW
TSVRLPTHVRPLHYDLSLHPNLTSRYVKGELTIKLTAIEETQQIVIHGHDLNVTSYKLHN
KYEKPIGISKFLEYPAHQQLYLKLDEILRRGSNYTLRLSYEFTLKEGLEGFYLSSYKTAN
GEKRYIATTHFEPTAARAAFPCFDEPQLKAKFHLSIYREPHQFTLFNMPLQTSVKAEDSD
LILDQFQESVEMSTYLVAFVVCDYDHVTNKTSNNVSVSVYAPPMMISQASYALRMATQIL
DFYESFFGVPYPLPKQAILTLPLSQSILCRWSDLWLNEGFASFMENLGTGVAEPGWAMQE
QFIVEKMQPALSLDALLASHPISTPVDDPAQIESIFDTISYKKGASIIGMLESFIGQDML
KAGSDIYLEAHSPDSDTQEIAAMISRYVKGIMDTWTLQAGFPLISVGLEDGLVTASQARF
LVCEENVTDPNEPLNSTLGYKWHVPLTYVTSANPKNETMHWMNLTDVEFEVGKEVKWIKF
NVGQRGFYRVTYDEGGWDALIHVLQTEPHTLSPADRASLLDDAFTLVKAGTINATVALNL
SLYLKRESLYIPWHTALNHLFSWVQLLFNYSAHTLMLEYIHTLILPHYERVGWMDTGTHI
ERLLRSEILMAAVECGNIQAIEEAQKRFAAWRNKNESIPPNLRSVVYKTGVRYGTEEDWR
HCWQVYNTSSIPSEKSLMLKAMAQTRDPWLMQQYLEYTLDGSKIRPQDVMIVLSEVSQNP
GGRLSAWRMVRQHWTQISQLFGHGSFTIGAIIKAVTSPFTSAFDLGEVESFFSNVDVGPG
ERALAQALETIRLHIQWHEHNLDDVTQWLHQQLSQPEGRDE
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggagggacctatgaggatgtccgacgtgctaaccaactcacagcctcataataactac
aacacactaaacaatgaggagaattcttcaggatcgcccaatgaaagcggcttcatggtt
aacaaacgtgctatgtacgagcccggggcagtgatggtgtgctcccaaaaacgggcttgc
tgtgtcgtcaccctcgggttcgttgccatcatcgctgtcgccctcattgtagccttcact
aagccaggatgcccagaggctacttatacaggagagccgttgccaggccagagcatccgg
ccaacaagctctccccctacaacaccccctactgccaccaatggagagctgttcccatgg
accagtgttcgattaccaacacacgttagacctttacactatgaccttagtctccatcct
aatttgactagtagatatgtcaaaggtgaattaaccatcaagttaactgcaatagaagaa
acacaacagatagtcatccatggccatgacctgaatgtaacttcatataagctccacaac
aaatatgaaaagccaatcggtatcagcaagttcctcgagtatcctgcccaccaacagcta
tatctcaagctggatgagattttacgtcgaggaagcaattacacgctgcggctaagttat
gaattcaccctgaaggagggacttgagggattttacctgtcatcctacaaaacagccaat
ggagagaaaaggtatatcgctaccacccactttgaaccaactgcagcacgtgcagctttc
ccctgctttgacgagccacagctgaaagccaagttccacctgagtatttaccgagaaccc
caccaatttacccttttcaacatgccgctacagacatcagtcaaagcagaggattcggac
ttgattcttgaccagtttcaagagagcgtggaaatgagcacataccttgtagcttttgta
gtatgcgattacgaccacgtgaccaacaaaacaagcaacaatgttagtgtctcagtctac
gctcctcctatgatgataagccaagccagttatgctctacgtatggccacacagatcctc
gacttctatgagtctttctttggggttccgtatcccctccccaagcaagctatcctaacc
cttcctctgagtcaaagtatcctctgcaggtggagtgacctatggcttaatgagggtttt
gcaagcttcatggaaaacttgggaacaggtgttgctgaaccaggctgggccatgcaggag
caattcatagtagagaagatgcagccagccctttccctagatgcactcctggcctcccac
ccaatctcaacccctgtggatgaccctgcacagattgaatccatatttgacacaatttca
tataaaaagggtgcatccattattggcatgcttgagtccttcattgggcaggacatgctg
aaggcaggatctgatatttaccttgaggcccatagccctgacagtgatactcaagaaatc
gcggccatgatatctcgatatgttaagggaatcatggacacgtggaccctccaagctggg
ttcccgctcatcagtgtcggcttggaggatggactcgtgacagctagccaagcacgattc
ctagtgtgtgaggagaatgtgactgaccccaatgaacccctcaactccacactgggatac
aagtggcatgttcccttaacctatgttaccagtgccaacccgaagaatgagacaatgcac
tggatgaacttgacagatgtggaatttgaagtgggcaaggaggtcaaatggataaagttc
aatgttggacaacgaggcttctatcgggtcacctatgatgaggggggttgggatgccctc
atccatgtgttgcagacagagccccacacactttccccagccgacagggcatcactgctc
gatgatgccttcacgctggtcaaggccgggaccatcaatgcaacagtggcgttgaacctg
agcctctaccttaagcgggagagcctgtacatcccttggcacacggcactaaatcacctc
ttcagctgggtacaactgctcttcaactactctgcacacactcttatgcttgagtatatc
cacacccttatattaccacactatgagagggttggatggatggacacaggcacgcacatt
gaaaggcttttgcgatctgagattctcatggcagcagtagaatgtggtaatatacaagcc
attgaggaagcccagaaaagatttgctgcctggcgaaacaagaatgagtcaattccaccc
aatctccgctctgttgtctacaaaacaggagtcagatatggcacagaggaagactggagg
cactgttggcaggtttacaatacatcctcgatccccagcgagaagagcctgatgttgaag
gccatggcacagactcgtgacccctggcttatgcagcaataccttgagtacactcttgat
ggctccaagatcaggccacaggacgtgatgattgtcctgagtgaggtcagccaaaaccct
ggtggaaggctctcggcctggaggatggtacgccagcactggacacagatttcgcagctc
ttcggccatggctccttcaccattggggcaatcattaaggctgttacttctcccttcact
tcagcttttgacttgggggaggttgaatcattcttcagcaatgtggatgtgggtcctggg
gagcgtgcacttgcccaggcacttgagaccatcagactgcacattcagtggcacgaacac
aacctggatgacgtgacacagtggcttcaccaacagctgtcccagccagaaggaagagat
gaatag

DBGET integrated database retrieval system