KEGG   Penaeus vannamei (Pacific white shrimp): 113813438Help
Entry
113813438         CDS       T06111                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00010  Glycolysis / Gluconeogenesis
pvm00053  Ascorbate and aldarate metabolism
pvm00071  Fatty acid degradation
pvm00280  Valine, leucine and isoleucine degradation
pvm00310  Lysine degradation
pvm00330  Arginine and proline metabolism
pvm00340  Histidine metabolism
pvm00380  Tryptophan metabolism
pvm00410  beta-Alanine metabolism
pvm00561  Glycerolipid metabolism
pvm00620  Pyruvate metabolism
pvm00981  Insect hormone biosynthesis
pvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113813438
   00053 Ascorbate and aldarate metabolism
    113813438
   00620 Pyruvate metabolism
    113813438
  09103 Lipid metabolism
   00071 Fatty acid degradation
    113813438
   00561 Glycerolipid metabolism
    113813438
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    113813438
   00310 Lysine degradation
    113813438
   00330 Arginine and proline metabolism
    113813438
   00340 Histidine metabolism
    113813438
   00380 Tryptophan metabolism
    113813438
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    113813438
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    113813438
Enzymes [BR:pvm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     113813438
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF3830
Motif
Other DBs
NCBI-GeneID: 113813438
NCBI-ProteinID: XP_027221217
Position
Unknown
AA seq 523 aa AA seqDB search
MLRSVLQRTALIRAASKHSAPSTAAFSNAAIPQPITSPDIHYTGVFINNEFHKAESGRQF
PTVNPATGEVIAMVEEGDKADVEKAVKAARKAFSLNSEWRQMDAYDRGQLLYRLADLMER
DRVYLASLETLDNGKPYTNSVMVDVELCIRNLRYFAGWADKVHGKTIPTDGPHFAYTRHE
PVGVCGQIIPWNFPLLMQAWKFGPALATGNTIVMKLAEQTPLSGLHVAKLVAEAGFPPGV
VNVIPGFGPTAGAAIASHMDVDKVAFTGSTEIGHLIQQAAGASNLKRVTLELGGKSPNIV
FKDADLEYAVEQSHFGVFFNQGQCCCAGTRIFVEDAVYDEFVERSVERAKVRKVGDPFDF
KTEQGPQVDGEQMNKILEMIDSGKKEGAKLVHGGARVGEKGYYIAPTVFADVQDNMRIAT
DEIFGPVQQIMKFSDVSEVIERANNTSYGLAASVFTKDLDKANMFAQGLRAGTVWINCYD
VLNAQTPFGGYKMSGQGRENSEYALQNYTEVKCVITKLPVKNA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgctccgttctgcaacgtactgctttgattagggcagcttcaaagcacagcgca
ccatctacggcagctttttcgaatgctgccattccacagccgatcacatcgcccgatata
cactatacaggggtattcatcaataatgaatttcacaaggctgaaagtggccggcagttc
ccaactgtcaacccagcaactggagaagtcattgcaatggttgaagaaggagataaggct
gatgtggaaaaggctgtaaaggctgctcgtaaagccttttctttgaactcggagtggagg
cagatggatgcctatgaccgtggccagctcctgtacaggctggctgacctgatggagcgc
gacagggtctaccttgctagtctggagacacttgataatggcaaaccttacacgaactca
gtcatggtggatgtagagctttgtattcgcaatcttcgctactttgctggatgggctgac
aaagttcatggtaaaaccattccaactgatggccctcacttcgcatacacacgccatgaa
cctgttggtgtttgtggccagatcattccgtggaatttccccctcctcatgcaggcatgg
aagtttggaccagcacttgcgacagggaacacaattgtaatgaagctagcagaacagacc
ccactttccggcctgcatgtggcaaaattagtggctgaggctggattcccacctggggta
gtcaatgttattcctggttttggcccaactgctggggctgcaattgcctctcacatggat
gttgacaaagtagcctttacaggatcaactgagattggtcatcttatccagcaagctgct
ggtgctagcaacttgaagcgagtaactctggaactgggaggcaagagtccaaatattgtt
tttaaggatgcagacttggaatatgcagttgagcagtcacactttggggttttctttaac
caggggcaatgttgctgtgctggcacaaggatctttgtagaagatgctgtttacgatgaa
tttgtggaacgcagtgtagaacgtgctaaagtccgtaaagttggtgatccttttgatttc
aaaactgagcaaggcccacaggtggatggtgaacaaatgaacaaaatcttggaaatgatt
gattctggcaagaaggaaggtgcaaagttggttcatggaggtgcccgtgttggagaaaaa
ggatattatattgccccaacagtttttgcagatgtgcaggataacatgcgtattgctaca
gatgaaatctttggaccagtgcaacagattatgaagttcagtgatgtcagtgaggtgatt
gaacgtgcaaataatacttcttatggcctagctgcttctgtgttcacaaaggatttggac
aaagcaaacatgtttgctcaaggactgcgtgcaggaactgtatggatcaattgctatgat
gttctgaatgctcagacaccgtttggaggatacaagatgtcaggacaggggagagagaac
tccgagtatgccctgcagaactacacagaagtgaagtgtgtcattaccaagttgccagtc
aaaaatgcctaa

DBGET integrated database retrieval system