KEGG   Penaeus vannamei (Pacific white shrimp): 113813522Help
Entry
113813522         CDS       T06111                                 

Definition
(RefSeq) glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00480  Glutathione metabolism
pvm00980  Metabolism of xenobiotics by cytochrome P450
pvm00982  Drug metabolism - cytochrome P450
pvm00983  Drug metabolism - other enzymes
pvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113813522
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    113813522
   00982 Drug metabolism - cytochrome P450
    113813522
   00983 Drug metabolism - other enzymes
    113813522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pvm02000]
    113813522
Enzymes [BR:pvm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     113813522
Transporters [BR:pvm02000]
 Other transporters
  Pores ion channels [TC:1]
   113813522
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C GST_C_3 Tom37
Motif
Other DBs
NCBI-GeneID: 113813522
NCBI-ProteinID: XP_027221320
Position
Unknown
AA seq 266 aa AA seqDB search
MPLDFYYMDMSPPCRAVMLTAKAVGVDLNLKLVNIMTGDHRKPEFLKVNPQHKIPFLVDG
TVKLSESRAICSYLASQYGKDDSFYPNNPKARCIVDQRLYFDIGTLYQKWADYAYPGLRG
QPINHSLLEGIHEALSFLNANLMDFPWAAGNKITVADFSLVATISSMEAAGVNLEQHPRI
VQWLKRCKTKMVGYQEANEVGAQKFGDILKGMLAPPAPEKKEEEKAEEKKEEKAEEKKEE
VNTEKKEDDKPVKKEDTSDSSSDEEK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgccactggacttttattacatggacatgtcccctccttgccgagccgtgatgctcact
gccaaggctgtgggagtcgacctcaacctaaagctcgtgaacatcatgacaggcgaccat
aggaagccagaattcctcaaggtcaacccgcagcacaagattccctttttggtggacggc
actgtcaagctgtctgagagccgtgccatctgctcatacttggcatctcagtacggcaag
gatgactccttctatcccaataacccaaaagcacgatgcattgtggatcagaggctttac
ttcgacatcgggaccctctaccagaaatgggctgattatgcttaccctggcttaagaggg
cagccaatcaaccactccctgcttgagggcattcatgaggctctctcatttttgaatgcc
aacctcatggactttccttgggcagcaggaaacaagattacagttgctgacttcagcctg
gtggccaccatatcgtccatggaggctgctggtgtaaacctagagcagcatccccgcatt
gtgcagtggctgaagaggtgcaagacaaagatggtcggctaccaggaggcgaacgaggtt
ggggctcagaagtttggggacattctgaagggcatgcttgcacccccagcacctgaaaag
aaggaagaggagaaggcagaagagaagaaagaggagaaggcagaagagaagaaggaggaa
gttaatacagaaaagaaagaggatgataaaccagtaaagaaggaagatacatcagattca
tcatcagatgaggagaaataa

DBGET integrated database retrieval system