KEGG   Penaeus vannamei (Pacific white shrimp): 113815699Help
Entry
113815699         CDS       T06111                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    113815699
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pvm01001]
    113815699
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pvm03036]
    113815699
Enzymes [BR:pvm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113815699
Protein kinases [BR:pvm01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   113815699
Chromosome and associated proteins [BR:pvm03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    113815699
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_C APH CENP-F_leu_zip Adeno_E3_15_3 Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 113815699
NCBI-ProteinID: XP_027223522
Position
Unknown
AA seq 798 aa AA seqDB search
MESINDTDRLQRLQDLEGQLRDPRGVMNVDSLLDSMQAMVADLDHQAIKRNKNVEAFLNR
YREAVLDVEILRMRADDFINIKVIGRGAFGEVQLVRHKFTKQIYAMKLLSKIEMIKRSDS
AFFWEERDIMAHANSEWIVQLHFAFQDSKFLYMVMDYMPGGDLVNLMSNYDVPEKWAKFY
CAEVVLALDAIHSMGFVHRDVKPDNMLLDGSGHLKLADFGTCMKMDKDGLVRSDTAVGTP
DYISPEVLKSQGGEGVYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYGKIMDHKNSLK
FPDDIEISVDAKTLICGFLSDRLTRLGRNGIEEIKCLRFFLNDQWTFDTIRECVPPVVPD
LASDDDTSNFDEVENEDTPEESFGTPKAFVGNHLPFVGFTYSRDYQLLTSSDKTDGKRNL
ASDGMDSSNEIAVLTAELEHQRNQVEELDSKYRVTLNQLDSLIQKEQERLQEKRDLERKL
ALLQHDLKEAQRKGEYEGESRRKLDALYQEVKKKLEDEQNKRTRDLNSAQHVSDKLNSLE
KQIKEVQDKLKVETDNNTRLRKQNAELTVMNQQKETSISDLSDKISSVQSIRDALERDIA
NLGAQLEQERGQRNHQTELISQADGKIQSLQAKLENASEREQVARKEAEKVSERLVQLEK
DRTSLELELRGMTSRYEQEARALREANAAPTHNHQSSAQALAALQERLNLEKQKRQQAEA
SSQEKERQNSMLSVDYRQLQQQLHKLEGEHRKECEKGAAPPDAINIMKQCWAELPEMRPD
FNQIHDLFKKLNQGRSGL
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaatcaatgacacagaccgtctgcagcgcctccaggatctggaggggcagctg
cgggacccccggggtgtcatgaatgttgactctctcctggactcgatgcaggcgatggtc
gcggacttggatcatcaagccatcaaaagaaataaaaatgtggaagcctttcttaataga
tatcgggaggctgtgttggatgtggagatacttcgaatgcgtgccgatgacttcattaat
atcaaagtcatcggcagaggggcatttggagaagtacaactagttagacataaatttaca
aagcagatctatgcaatgaaattactgagcaaaattgagatgatcaaaaggtctgattct
gcctttttctgggaagaacgagacattatggctcatgctaactcagaatggattgttcag
ctgcattttgccttccaagattcaaaatttctttacatggtcatggattatatgccaggt
ggtgacttagtgaacctgatgtccaactatgatgtaccagagaaatgggccaagttctat
tgtgcagaagtggtcctagccctggacgcaatccattccatgggatttgttcacagagat
gtaaagccagataacatgcttctggatggtagtggtcacctcaaactggcagactttggt
acttgtatgaagatggataaggacggactcgtaagatcagacacagctgtgggaacacca
gactatatctctcccgaagtcctcaagtcacagggtggtgaaggggtctatgggagagag
tgtgattggtggtctgttggtgtcttcctctatgaaatgctagtgggtgacacgcccttc
tatgcggattcgttggttggcacctacggcaaaattatggatcacaaaaattcactaaag
tttccggatgatattgaaatttccgttgatgccaagactttgatctgtggtttcttgtct
gacagattaacaagattaggtagaaatggtattgaagaaataaaatgtcttcgattcttt
ctcaatgatcagtggacatttgacacaattagagaatgtgtaccccctgttgtgcctgac
ctcgcaagtgatgacgacactagtaattttgatgaagtggagaatgaggacactcctgaa
gaaagctttggaacccctaaagcctttgtcgggaaccatctaccatttgtggggttcact
tactccagggattaccaactactcacttcttcagacaagactgatggcaaaagaaatttg
gcaagtgatggtatggatagcagtaacgagattgctgtgctgacagcagaattggaacac
cagagaaatcaggtggaagagctagactccaagtacagagtgaccctaaaccagctggat
tcactcatacaaaaggagcaggagagactacaggagaagagagatctagaacgaaagttg
gctttattacaacatgacctcaaagaagctcagagaaagggggagtatgaaggtgagagt
agacggaagctggatgccctatatcaggaggttaagaaaaagctcgaagatgaacaaaac
aaacgcactagggacctgaactctgcgcaacatgtcagtgacaagctgaactctcttgaa
aagcagataaaagaagttcaggacaaactgaaggttgagacagacaacaacacaagattg
cgtaaacaaaatgcagagctaacagtcatgaaccagcagaaggaaacgtccatttctgac
ctctcagataagatatcaagtgtccagtccatccgtgatgcgttagagcgtgatatagca
aaccttggagcacagttagagcaggagcgtgggcagaggaaccaccagactgagttgatc
tcacaagctgatggcaaaattcaaagtctacaagcgaagcttgaaaatgcatctgaacgt
gagcaagttgcccgcaaggaagcagaaaaggtttccgaacgtcttgtacagttagagaaa
gatagaacatctctagagttggaattaagagggatgacaagcagatatgagcaagaagct
cgggccctacgcgaagctaatgctgcccccacacacaaccaccaatctagtgcacaggct
ctagcagctttgcaggaaaggctcaatttggagaagcagaaacgccagcaagcagaggca
tctagtcaggagaaggaacgtcagaactctatgttgagcgttgactaccggcagctccag
caacagctacacaagcttgaaggggagcacaggaaggagtgcgagaagggcgcggcgccc
cccgacgccatcaacatcatgaagcagtgctgggcggagcttcccgagatgcgacccgac
ttcaaccagatccacgacctcttcaagaagctcaaccagggcaggtcaggtctctga

DBGET integrated database retrieval system