KEGG   Penaeus vannamei (Pacific white shrimp): 113817042Help
Entry
113817042         CDS       T06111                                 

Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial-like isoform X1
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00020  Citrate cycle (TCA cycle)
pvm00640  Propanoate metabolism
pvm01100  Metabolic pathways
pvm01200  Carbon metabolism
Module
pvm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pvm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113817042
   00640 Propanoate metabolism
    113817042
Enzymes [BR:pvm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     113817042
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     113817042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA
Motif
Other DBs
NCBI-GeneID: 113817042
NCBI-ProteinID: XP_027224839
Position
Unknown
AA seq 114 aa AA seqDB search
MGIGGYPFTSTNLIDCLDTFLKDLNAKGILIGEIGGGAEEAAPGPEAKPVSSFITGLSAP
PGRSMGHASAIISGGKRGAEDKIKALENVGVIILRCPVQMGNMLLAEMELLEKL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgggcattggtggataccccttcactagcactaacctcattgactgtctcgacactttc
ctcaaggatctcaacgcaaagggtattctcataggtgagattggtggtggtgctgaagag
gctgcacctggacctgaagccaagcctgtttcatcctttatcactggtctttctgcccca
cctggtcgcagcatgggacatgccagtgccatcatctctggaggcaagagaggtgctgaa
gacaagattaaggcccttgagaatgttggtgtaatcatcctgaggtgccctgtgcaaatg
ggaaatatgttactggcagagatggaacttcttgaaaaattgtaa

DBGET integrated database retrieval system