KEGG   Penaeus vannamei (Pacific white shrimp): 113818701Help
Entry
113818701         CDS       T06111                                 

Definition
(RefSeq) lactosylceramide 4-alpha-galactosyltransferase-like
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00601  Glycosphingolipid biosynthesis - lacto and neolacto series
pvm00603  Glycosphingolipid biosynthesis - globo and isoglobo series
pvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    113818701
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    113818701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pvm01003]
    113818701
Enzymes [BR:pvm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     113818701
Glycosyltransferases [BR:pvm01003]
 Glycan extension
  P blood group
   113818701
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug DUF1157
Motif
Other DBs
NCBI-GeneID: 113818701
NCBI-ProteinID: XP_027226688
Position
Unknown
AA seq 393 aa AA seqDB search
MELMLKKLQSPRTLVVLAFITTATVVCVLPNTNQILVKVKNQYIFNNTEYDASEEYADGD
QDSQENKTQTSAPEISIEWWQKELCKPEVLQLQPTTTYLRLPMLGRDIIPSPNDYNVFLG
ETACNPQPLYRAYCSVESYAHENPTAKVWYHTTSPLIDNGDGLFTNLEEAYENLKVVGTD
LTKIFNGTPCEKVFMAGKWAHNTPWPANNISNLLRNVLLWLWGGLNSDTDCICVRNLTHI
RNMVSYDEQDKVVNNAIMHFDAGHPFTYELMEYLKENFKVATWVVNGPGAATAIAKKVCG
TEDLNEVLLHHCANVTLRPLKEMQLFRWPDWNNYFQDNKGERFAEEHQDAFIVHLYNLAK
KTIRIGNKGIYDEIAKAHCPITYAAAKRRAYFF
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggagttgatgttgaaaaagctacaaagcccaaggacccttgttgttcttgctttcatc
acaacggctacggttgtatgtgtattgccgaatacaaaccaaatcttagtaaaggtcaag
aatcaatatatattcaacaatactgagtatgatgcttcagaggaatatgcggatggagac
caggattctcaagagaacaaaactcagacatcagcaccagagattagcatagaatggtgg
caaaaagagttatgtaagccagaagttttgcagcttcaacctaccacgacctatttgagg
ttaccaatgcttggcagagacatcatacccagcccgaatgactacaatgtgttcttggga
gagaccgcatgcaatcctcagccactgtatagggcatattgttctgtcgaaagctatgca
cacgaaaacccgacagcgaaggtctggtaccacactacatccccgctgatcgacaacgga
gacggcctattcacgaacctcgaagaggcctacgagaacctgaaagttgtaggcactgac
ctcaccaagattttcaatggaactccgtgcgagaaagtattcatggcagggaaatgggcg
cacaatacgccttggcctgcgaataatatatccaacttgttgagaaatgtgctgctgtgg
ctgtggggaggattgaacagtgacaccgattgtatctgcgtgaggaaccttacccacata
cggaacatggtttcttatgatgaacaggacaaagtggtcaacaacgccatcatgcacttc
gacgcagggcacccgttcacctatgagcttatggaatatctgaaggaaaacttcaaggta
gccacatgggtggtcaacggccctggggcagcaacagccatagcgaagaaggtgtgtgga
acagaggatctgaacgaagttttgctccatcactgtgcaaacgtgacactgcgtcctctg
aaggaaatgcagctgttccgatggcctgactggaacaactatttccaggacaataaagga
gaacgttttgcggaggagcatcaagatgccttcatcgtacatttgtataacttagccaaa
aaaaccatccgaattggaaacaagggcatctatgatgagattgccaaagctcactgccct
atcacttacgcagctgccaaacggagagcctactttttctaa

DBGET integrated database retrieval system