KEGG   Penaeus vannamei (Pacific white shrimp): 113822264Help
Entry
113822264         CDS       T06111                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic-like
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00450  Selenocompound metabolism
pvm00970  Aminoacyl-tRNA biosynthesis
pvm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    113822264
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113822264
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pvm01007]
    113822264
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pvm03016]
    113822264
Enzymes [BR:pvm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     113822264
Amino acid related enzymes [BR:pvm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   113822264
Transfer RNA biogenesis [BR:pvm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    113822264
 Prokaryotic type
   Other AARSs
    113822264
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g WHEP-TRS tRNA-synt_1 DUF2274
Motif
Other DBs
NCBI-GeneID: 113822264
NCBI-ProteinID: XP_027230612
Position
Unknown
AA seq 823 aa AA seqDB search
MQDQTLIKECIKQWCGQGSVLKTWVVNASIPLSPSHSTLALLRSQAAMPHGTVTSATEQV
KPVKAAITTEQLAEAKSAWTNPSKLSCDEKVSRQGPVVPVDGEHNVLITSALPYVNNVPH
LGNIIGCVLSADCFARFCRLRGDNVLYICGTDEYGTATETKALAEGLTPQQICDKYHAIH
SKVYQWFGISFDYFGRTTTEHQTKICQDIFWSLEKNGKISKDSVDQLYCSKCDRFLADRF
VEGVCPYPGCGYEDARGDQCDACGKLINAIELVKPRCKLCSTSPEVRSSNHLFLDLPKIE
KSLSEWLSTSSKQWTNNAKVICDTWVRDGLKTRCITRDLKWGTPVPLDGFKDKVFYVWFD
APIGYVSITANYTNEWEKWWKNPSQVNYYEFMAKDNVPFHSVVFPSTQLGTGENWTMVNY
LVATEYLNYEDGKFSKSRGVGVFGDQAIETGIPSDVWRFYLLYLRPEAQDTAFSWVDLQT
KNNSELLNNFGNFIHRALSFVFKFFEAAIPEAKPDESDFMLMAAVNQELKHYTTALANNR
QRDGLRAILSITKIGNQYIQEHEPYKLVKPNRTEKEKERGASVIAIAANLVCLVSIIADP
YMPEIAKNIRGFLNLSSQQTRLPGHFCCLLPAGHKIQEPKPLIIQIDDETVNKFKEQFAG
KAPSEKKAADPAEIAKLEAQIAEQSAKVRKLKESGTASKDEILAEVTILLSLKGQLAALQ
GVDPAAGGKEKKKKKGGGAGKEQAKVPPASSSVAPATIVNPAEVERLQGLVTEKGGKVRA
LKGSGTASKEEIATEVLGLLKLKEELALAQGIDPSTLNAKKKK
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatcaaacactcataaaagaatgtatcaagcagtggtgtgggcaaggatcagtt
ttaaaaacttgggttgtaaatgcaagtatacccctgagtccctcccattcaacgctagca
ttattgaggagccaagctgccatgcctcatggaactgttacatcagcaactgaacaggta
aagccagttaaagctgcaataactacagagcagttagcagaagcaaagtctgcttggaca
aacccctcaaaattatcatgtgatgaaaaggtgtccaggcagggcccagtggtgccagta
gatggagaacataatgttctcattacatcagctttgccttatgttaacaatgtacctcat
ctggggaacatcattggatgtgtactctcagctgactgttttgccagattttgtcgctta
agaggggacaatgttctttatatttgtggtactgatgaatatggcacagctactgagact
aaggctttggctgaggggttgactcctcagcagatttgtgacaagtatcatgccatccac
agcaaggtttaccagtggttcggtatcagttttgactattttggcaggactaccactgaa
catcagaccaagatttgtcaagatatattttggagcttggaaaagaatggaaagattagc
aaagattcagttgatcagttgtactgtagtaagtgtgaccgtttcttggcagacagattt
gttgagggggtttgtccctaccctggctgtggctatgaggatgcaagaggtgatcaatgt
gatgcttgtggtaagttgatcaatgccattgaacttgtcaaaccaagatgtaaactttgt
tctacatcccctgaagtcaggtcctctaaccatctcttcctggacttaccaaagattgag
aagagtttatcagaatggcttagcacgtcctcaaaacaatggacaaataatgccaaagtg
atttgtgacacctgggtaagggatggattgaaaactagatgtatcacaagggacttgaaa
tggggaacacctgttcctctagatggattcaaagacaaggtcttttacgtttggtttgat
gcacctattggttatgttagtattacagctaattatactaatgaatgggagaaatggtgg
aagaatccttcccaagttaattattatgagttcatggccaaggataatgttccattccat
agtgtggtatttccctctactcaacttggaacaggggaaaactggactatggttaattat
cttgttgcaactgaatatctgaattatgaagacggaaagttctctaaaagtcgaggagta
ggggtgtttggtgaccaggccattgaaacaggcattcctagtgatgtttggagattctat
ctgctgtatttaaggccagaagcacaagatacagctttttcatgggtagatcttcagact
aagaataatagtgaattgctgaataactttggcaacttcattcacagagctttgtccttt
gtgttcaagttctttgaagcagccatccccgaagccaaaccggatgagtcagattttatg
ttgatggcagcagtaaatcaggaacttaagcattacacaacagctttagccaataatagg
cagcgtgatggtcttcgggccatcctgtccattacaaagattggaaaccagtatattcag
gaacatgaaccttacaaactggtcaaacccaatcggacagaaaaagagaaggaacgtggg
gcatctgtcattgccattgctgccaacttagtctgtttagtgtcaataattgcagaccct
tacatgccagaaatagccaagaacatccgtgggtttttgaacctctcatcacaacagact
cgcctacctggtcacttttgttgtctgttgccagctggtcacaagatacaggagcccaaa
ccccttatcatccaaattgatgatgagactgtgaacaagtttaaggagcagtttgcaggt
aaagccccatcagaaaagaaggcagcagatccagcagagattgcaaaacttgaggcacag
attgcagagcagagtgccaaagttcgcaagctgaaagaaagtggtacagccagtaaggat
gaaattttggctgaagttacaatattacttagcctcaaaggtcagctggcagctttgcaa
ggagtagatccagctgcaggagggaaagaaaaaaaaaagaagaagggaggaggagcaggg
aaggagcaggccaaggttcctccagcctcctcttcagttgctccagctaccattgtaaat
ccagctgaggtagaacggctacagggcttagtgacagaaaagggtggtaaggtgagggcg
ctgaaaggatcaggtacggcctccaaggaagagatcgcgaccgaggtgctaggtcttttg
aagctgaaggaagagctagcgttggcacagggcattgacccttccactctcaatgcaaag
aagaagaagtga

DBGET integrated database retrieval system