KEGG   Penaeus vannamei (Pacific white shrimp): 113823290Help
Entry
113823290         CDS       T06111                                 

Definition
(RefSeq) tripeptidyl-peptidase 2-like
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pvm01002]
    113823290
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pvm03110]
    113823290
Enzymes [BR:pvm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     113823290
Peptidases and inhibitors [BR:pvm01002]
 Serine peptidases
  Family S8: subtilisin family
   113823290
Chaperones and folding catalysts [BR:pvm03110]
 Intramolecular chaperones
  Subtilisin family
   113823290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII TPPII_N
Motif
Other DBs
NCBI-GeneID: 113823290
NCBI-ProteinID: XP_027231707
Position
Unknown
AA seq 1311 aa AA seqDB search
MRICLSNIFCRVVHIQTHRVRKSERYPKSLRSFATTTKMASTTEPLGEFPFWGLLPRKET
GVVSLLSKNPNFDGRGTVIAIFDSGVDPGAPGLQVTTEGKVKVIDRIDASGAGDVDTSTV
VEATDGVIAGLTGRKLKVPEAWVNPSGKFHIGVKSAYTLYPQRLRERIIKERKEKQWDPV
HKILLAEAQRKLQLLENNKSNGSSNGASPNSLIDKMTKEDAETRVSLLNSLEKKYNDLGP
AYDCVLYHDGDVWRACIDTSERGELESGIHLGEYRITHQWASLTSADQYNISVNVHNDGN
ILEIVGMCSSHGTHVASIASANFPDAPERNGVAPGAQIVSITIGDNRIGSMETGTALARA
MMRVMENSFYKVDVINMSYGEHAHWSNSSRLGELAHEVVNKYGVIWVSSAGNHGPALATV
GVPPDFQSDSIIGVGAYVSPDMMTAEYSMIEKLPGCPYTWSSRGPTADGARGVTVCAPGG
AITSVPTFTLRSNQLMNGTSMASPHTAGCVALIVSAVKLKSIPYSPYSVRRAIQNTAMAL
DVDVFAQGHGLIQVDRAVEHMLQHCNSIEDKVRFMVECGSERKKGIHLRNWLADKPVDMS
VTVEPVLLDDTRAADANQKLSFCMEMVLTTNAPWIRSPSCLQMSYTARSFQVSIDPRGLE
RGRVYFASVKAYNASNVEKGIMFEVPITIVVPVIDLLHGYKYTCPAEVFRAGCVRRHFLY
VPVESTWATVTLKSSHSEKCQRFTLHAVQLKPDCSVKTIEFYKVVNLGCNESSTFVLGVR
GGYALEVCLARWWSSLVDGQVEIDVEFHSLRPSHEEVTLFCSDGVQRVDVRAGLRPEEVS
PQAYLKHHTQVLTPTESKVEVLGGLRDTIPGGRPVYQLILSYNLSVSKAAEVTPKCALLS
DVLYESAFESQLWMLFDHNKQLLGSGDAYCTKYSLKLEKGEYTIRLHVRHERPDLLEKLS
DLPLTVLTKLSQEVKLDVFTSFNAAVTCGKKAQSLSLGTGAVQPLYLTAPSLTDKTLKGL
GLTPGQALLGTLSFAKDEQVRKAVSNHKFGPIRTMPDQYPLRVVVTELPCKKRSSTSTTT
SPEEKKETKTHTEYLEALRDLQTAWIAKLDCESGEQLHKELMAAHPEHLAAQLARLQALD
AGGAQNRQAVIAQAKQVVASVDVAPLLAFYGTKTDTRSDAAKIKTQMDKQRNTLLEAHCR
HGSALSADLIPLQLPERPQESVEQLDAITVEIMKFVEPSDSKVIGFFASYYQVRGFDGLA
ARLIQRQCEEKWTRENEAKLTEAYTRLGWTHAASLIANSHPLRFPTSFTLF
NT seq 3936 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttgcctctccaacatattctgtagagtagttcacatacaaacacacagagtg
aggaaaagcgaacgttatccaaaatctttacgttcgttcgccacaacaacaaagatggcg
tcgacgaccgaaccgctcggggagtttcctttttggggccttcttcctaggaaggaaact
ggtgttgttagtctactttctaagaacccaaactttgatgggcgtgggacagtgattgct
atctttgactcaggtgttgacccaggggcacctgggcttcaggttacaacagaaggaaaa
gtgaaagtcattgatcgcattgatgcatcaggagctggagatgttgatacatccacagtt
gttgaagccacagatggtgttattgcaggtcttactggtcgtaaactaaaagttccagag
gcctgggttaatccatcagggaagttccatataggtgtaaagagtgcctatactctctac
cctcaacggctgagagagcgaatcattaaggagcgtaaagagaagcagtgggaccctgtt
cacaaaattcttctggcagaggcacaaagaaagttacagttgttggaaaataataaaagc
aatggtagtagtaatggagccagccctaatagtttgattgacaaaatgacaaaagaagat
gctgaaaccagggtatcactgcttaacagcttggagaaaaagtacaatgacctgggacca
gcttatgattgtgtcctatatcatgatggagatgtgtggagggcatgtattgatacatca
gaacggggagaactggaatctggaattcatctaggggaatatagaattactcaccagtgg
gcatcgcttacgtcagctgaccagtacaatatctctgtaaatgtgcacaatgatggaaat
attcttgaaattgttggaatgtgttcaagtcatggtacgcatgtggcttccatcgcatca
gctaatttccctgatgccccagagaggaatggtgttgcccctggtgctcagatagtctcg
ataactataggtgacaatcgtattggtagcatggaaactggcactgcgctagccagagct
atgatgcgtgtgatggaaaactctttctacaaagtagatgtcatcaatatgagttatggg
gaacatgctcattggtcaaactcaagtcgattaggagaactggctcatgaagtagtcaac
aaatatggtgtcatctgggtatcatctgcgggcaatcatggtccagcccttgcaacagta
ggagttcctccagacttccagagtgattcaatcattggcgttggtgcttatgtgtctcct
gacatgatgactgctgaatactccatgattgagaagttgcctggatgtccatatacctgg
tcatcaagaggacccacagcagatggtgcaaggggtgtgactgtctgtgctccaggtggg
gccatcacatctgtcccaacatttacattgcgtagtaaccaacttatgaatggcacaagc
atggcatctcctcacactgctggctgcgtcgctctgattgtttcagcagtaaagttgaag
tccattccatattccccgtattctgtccgaagggcaatacaaaacactgccatggcctta
gatgtggatgtgtttgcacaaggacatggactgatccaggtggacagggctgtggagcac
atgcttcagcattgcaatagcatagaagacaaagttcggtttatggttgaatgtggaagt
gagaggaaaaagggcattcacttgcgtaactggcttgctgataaacctgtcgacatgtca
gttacagtggaacctgtactacttgatgacactagagctgcagatgccaatcaaaaatta
tccttctgtatggaaatggttctgacaactaatgctccttggatcagatcaccaagctgt
ttacaaatgtcttacactgccaggtctttccaggtgagcatagatcctcgaggtctggag
cgtgggcgagtctattttgcctctgtcaaggcctacaatgctagcaatgttgagaaagga
attatgtttgaagttccaatcactattgttgttcctgttattgacttacttcatgggtac
aagtacacctgtccagcagaggttttccgtgctggttgtgtccgccgtcatttcctgtat
gtgccagttgagtctacttgggcaactgttactttgaagtcatctcattctgagaaatgt
cagcgcttcactcttcatgcagttcagctgaaacctgattgcagtgttaagacaattgag
ttctataaggttgttaatctaggctgcaatgagagcagcacatttgtcttaggggtgcga
ggtggatatgctctggaggtttgccttgcccgttggtggtcaagcttagtggatggtcag
gtagaaattgatgttgaatttcatagtctgcggccatcacatgaggaggtaacattattc
tgcagtgatggtgttcaacgtgtggatgtgagagcagggctgaggccagaagaagtctct
ccacaagcttatctcaaacatcacacacaggtgctgacacccacagagagtaaagtggaa
gttttgggtggtctacgtgacacaatcccaggtggtcggcctgtctaccagctgatctta
tcttataatctctcggtttctaaagcagcagaggtaactccaaaatgtgctttgctaagc
gatgtgttgtatgagtctgcatttgagtcacagttgtggatgctgtttgaccacaacaag
caactcctaggctctggtgatgcttactgtaccaagtatagtctcaagcttgagaaaggc
gaatatacaatcaggcttcatgtgagacatgaacgacctgacttgctggagaagctcagt
gatttacccttgactgtgcttacaaaattatcgcaagaggtaaaacttgatgtgtttaca
tcattcaatgctgcagttacatgtggcaagaaggctcagtctctttcattgggtactggt
gctgtccagcctctctacctcactgctcccagcctcacagacaagacactgaagggtctc
ggactaaccccaggtcaggccctgttaggtacactgtcatttgcaaaggatgaacaagtt
cggaaagctgtaagtaaccacaagtttgggcccatacgtactatgccggaccagtatcca
ctgagagtggttgtgacggagttgccctgcaagaagcgcagctccactagcaccacaaca
agcccagaggaaaagaaggaaaccaagactcacactgagtacctagaagcactgagggat
ctacaaactgcatggattgctaagctggactgtgaaagtggagagcaattacacaaggag
ctgatggctgcacatccagagcatcttgcagcacaacttgcccgccttcaggctcttgat
gcaggtggagcccagaatcgccaagctgtcatagctcaggccaagcaggttgttgcatca
gtggatgtagcaccacttctagccttttatggcactaaaacagacacccgatctgatgct
gccaaaattaagacacagatggacaagcagcgcaacaccttgctggaggctcattgccgt
catggatctgctctgagtgctgatctgataccactacagcttcctgagagaccacaggag
tcagtagaacaacttgatgcaattactgtagaaatcatgaaatttgtggagccttcagat
tcaaaggtgatcggattttttgccagctactaccaagtcagaggatttgatggtctggct
gcacgtctgattcaacgacagtgtgaagaaaagtggactcgtgaaaatgaggctaaatta
actgaagcttatacccgcttgggctggacccatgctgctagtcttatcgctaattctcat
ccattacgttttcctacaagctttaccctgttctag

DBGET integrated database retrieval system