KEGG   Penaeus vannamei (Pacific white shrimp): 113826602Help
Entry
113826602         CDS       T06111                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Pathway
pvm00030  Pentose phosphate pathway
pvm00480  Glutathione metabolism
pvm01100  Metabolic pathways
pvm01200  Carbon metabolism
Module
pvm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pvm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    113826602
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    113826602
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pvm04147]
    113826602
Enzymes [BR:pvm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     113826602
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     113826602
Exosome [BR:pvm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   113826602
  Exosomal proteins of colorectal cancer cells
   113826602
  Exosomal proteins of bladder cancer cells
   113826602
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 113826602
NCBI-ProteinID: XP_027235295
Position
Unknown
AA seq 523 aa AA seqDB search
MSRPVVTKTESQGAEEMLSLLRQSLRSCKTPGETNFEGSAPHIFVVLGASGDLAKKKIYP
TLWWLFRDRLVPENTMFVGYARSGLTVAELREKCQQYMKVKEGEQERYEQFWGVNHYVRG
SYDTRRDFELLDQEMQKVGTARANRIFYLALPPSVFDVVTSNLKACCMASQGWSRVIIEK
PFGKDSESSAKLSNHLASLFKEEELYRIDHYLGKEMVQNLMTLRFGNRIFGRRGTGTTSP
RSSSRQGALRTQGRGYFDEFGIIRDVMQNHLLQILCLVAMEKPCSTAADDIRDEKVKVLK
SMQTLTLDDVVLGQYAGDPEGTTEDARLGYLDDPTVPAGSATPTYCLAVATINNERWDGV
PFILRCGKALNERKAEVRIQYRDVPGDIFHGQSKRNELVIRVQPGEAIYSKVMTKTPGMS
FALEETELDLTYSQRYKGSKLPDAYERLILDVFCGSQMHFVRSDELAEAWRIFTPLLHEI
EAKKPTPIPYKYGSRGPEEADAKLAASNFKYYGSYKWTQPSHL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcccggtcgtaacgaaaaccgagtctcagggagcggaggagatgctgtccctc
ctgcggcagagcctccggtcgtgcaagacgcccggagagaccaacttcgagggctcggcg
ccgcacatcttcgtggtgctgggcgcgtcgggcgacctggccaagaagaagatctacccg
acgctgtggtggctgttccgcgaccgcctggtgccggagaacaccatgttcgtgggctac
gcgcggtcggggctgacggtggcggagctgagggagaagtgccagcagtacatgaaggtg
aaggagggcgagcaggagcggtacgagcagttctggggcgtgaaccactacgtgcgtggg
tcgtacgacacccgcagggacttcgagctgctggaccaggagatgcagaaggtgggcacc
gccagggccaaccgcatcttctacctggcgctgccgccgtccgtgttcgacgtggtgacg
agcaacctgaaggcgtgctgcatggccagccaggggtggagccgcgtgatcatcgagaag
ccgttcgggaaggactcggagtcgtcggccaagctgtcgaaccacctggcgtcgctgttc
aaggaggaggagctgtaccgcatcgaccactacctcggcaaggagatggtgcagaacctc
atgacactcagattcggcaaccgcatcttcggccgacgtggaaccgggacaacatcgcct
cggtcttcatctcgtcaaggagcccttcgaacccaggggcgcggctacttcgacgagttc
gggatcatccgggacgtcatgcagaaccacctgctgcagatcctgtgcctggtggccatg
gagaagccctgctccaccgccgccgacgacatccgcgacgagaaggtgaaggtcctgaag
agcatgcagacgctgaccctggacgacgtggtgctgggccagtacgccggcgaccccgaa
ggcacgacggaggacgcccgcctcggctacctcgacgaccccaccgtgcccgccggttcg
gccacgcccacctactgcctcgccgtcgccaccatcaacaacgaacggtgggacggcgtg
cccttcatcctcagatgcggaaaggccctgaacgagcggaaggcggaggtcaggattcag
tacagggacgtcccgggcgacatcttccacggccagagcaagcggaacgagctggtcatt
cgcgtccagccgggggaagccatctattcgaaggtcatgaccaagacgccaggcatgtcg
tttgctcttgaagagacggagttggatctgacgtacagccagcgctacaagggatccaag
ctgccagatgcttatgagcgcctcattctcgacgtcttctgtggatcccagatgcatttt
gtcaggagtgatgagctggcagaggcatggcgcatcttcacacccctcttgcatgagata
gaggccaagaagccaacacccatcccttacaagtacggctcccgagggcccgaggaggca
gatgcaaagctggccgcaagcaacttcaagtattacggctcctacaagtggacacaaccc
agtcacttgtaa

DBGET integrated database retrieval system