KEGG   Penaeus vannamei (Pacific white shrimp): 113826815Help
Entry
113826815         CDS       T06111                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase G-like
  KO
K09566  peptidyl-prolyl isomerase G (cyclophilin G) [EC:5.2.1.8]
Organism
pvm  Penaeus vannamei (Pacific white shrimp)
Brite
KEGG Orthology (KO) [BR:pvm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pvm03041]
    113826815
   03110 Chaperones and folding catalysts [BR:pvm03110]
    113826815
Enzymes [BR:pvm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     113826815
Spliceosome [BR:pvm03041]
 Complex C
  Other components
   PPlases
    113826815
Chaperones and folding catalysts [BR:pvm03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    113826815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TFIIA
Motif
Other DBs
NCBI-GeneID: 113826815
NCBI-ProteinID: XP_027235505
Position
Unknown
AA seq 736 aa AA seqDB search
MEHRVRCFFDIEVDGIPSGRVIFELFSEECPKTCENFRALCTGEMGLGKTTNKPLHYRGV
KFHRVIKDFMIQAGDFSAGNGTGGESIYGGHFEDESFKLQHDIPFLLSMANRGKDTNGSQ
FFVTTQPSSHLDGKHVVFGRVVSGEEVVTAIENLPVDNRSRPLQPAVIANCGELILQRSS
KVKEKKRKKKKESSSSSSDSDSDEKKKKKKKKEKKQKKHKKAESSDEEGEVKEDDINEEG
DSSKLRTHPLVSVSVINPDEIPDVPKNRFLYRAGPEKDEEGRMERGRDRTRAAVRAYTKS
GRKVKGRGSLRYRTPSRSRSRSRSVTPPHWRQAQRRTISYEQLQKRKEDKIRREEDRQVR
QQEREQEIEERRRRREERHRENEGHDGRNPDMGNRPDTFGRDFGRGNWRENRDKMRRGFR
DGRNPQGWRNGRERTRGEQDWREARERTRTEDDWREGRNRDQRGDRGDDYGHRGDLREKI
RNQRDRFVPGHGDSGENNQSQKREEQSDEETGSKSQREDKEKQRSKDKQDDLDETALDYE
AMDNDDDDDDDEGEPAKKSNGTVNEEEPKSHDQSPVANEDAAAEKEEEKNTVKEQKKDEA
SDRKKGSRDRSGRAHSHERRGRDRSRSRDRRQDRFRSRRDRSRERQNRPRDRRGRSRDRN
SRRDRSRDRSRNRSRDKSRDRSRDRSRDRSRDRSRDRSRDRSKDRSRDKRDRSRSRDKTN
ERRRKYSSGSDSSDSD
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggagcatagggtgcggtgcttcttcgacatagaagttgatggcattccatctggccga
gtcatctttgagctcttcagtgaagaatgtcctaagacatgtgaaaattttcgagccctt
tgtacgggtgagatgggattgggtaagaccaccaacaaaccacttcattatcgaggggta
aagtttcacagagtgattaaggacttcatgatccaggctggagacttctcagctggaaat
ggcacaggtggcgagtctatatatggtggacattttgaagatgaaagctttaaactgcag
catgatataccgtttctactgtccatggctaaccgtgggaaagacacaaatggttcacag
tttttcgtaacaactcaaccctcttcgcatcttgatgggaagcacgtcgtgttcggtcga
gtggtgagtggagaggaggtggtgactgccatagagaaccttcccgtggacaaccgcagc
cggccgctccagcctgcggtgatagcaaactgtggagagttgattctccagcgatcaagc
aaagtaaaagaaaagaaaaggaagaaaaagaaggagtcatcctcatcctcatcagactca
gattctgatgaaaaaaagaaaaagaagaagaagaaagaaaagaaacagaagaaacataag
aaagcagaaagctctgatgaagaaggtgaagtgaaggaagatgatattaatgaggaaggt
gattccagcaagttacgcacccatccattagtgtctgtctctgtcattaaccctgatgaa
atcccagatgtcccaaaaaacagatttttatatcgtgctgggccagagaaagatgaggaa
ggccgtatggagagaggcagagacaggacaagggctgcagttcgagcttacacaaagagt
gggcgcaaggttaaagggcgagggtcattgcgttatcgcacaccttcacgatcaaggagt
cgttctcggagtgttacaccacctcactggcgtcaggcacagcggcgcaccatctcctat
gaacaactgcagaagaggaaggaagacaaaataagaagagaagaggaccgtcaagtacgg
cagcaggaaagggaacaggaaattgaggagaggaggcggaggcgggaggaacgccaccga
gagaatgagggccatgatggcaggaatccagatatggggaatcgccctgacacttttggc
cgggattttggaagaggaaactggcgagagaaccgtgacaaaatgaggagaggtttccgt
gatggaagaaatcctcaaggttggcgcaatgggagggagaggacaagaggagaacaggac
tggcgtgaagcgagagaaagaactcgcacagaagatgactggcgtgaaggaaggaatcgt
gaccagagaggagaccgtggagatgattatggtcatagaggggatctgcgtgagaagata
cgaaaccagcgtgatagatttgttccaggccatggggattctggtgaaaacaaccagtct
cagaaaagagaagagcagtctgatgaagagacagggtcaaaatcacagagagaagacaag
gagaaacaaagaagcaaggacaaacaagacgacttggatgaaactgccttggattatgaa
gctatggataacgatgatgatgatgacgatgatgaaggagaaccagccaagaaaagcaat
ggcacagtgaatgaagaagaacccaaaagccatgaccaatctcctgttgcaaatgaagat
gcagcagctgagaaagaagaagaaaaaaacacagtaaaggagcagaagaaggatgaagca
agtgaccgtaagaaggggagcagggatcgcagtggcagggctcactctcatgagcgaagg
ggcagggaccgctctaggtcacgtgacagaaggcaggacaggttccgcagcaggagggac
cgctccagggagaggcagaacaggccccgtgacagacggggacgttcaagggataggaac
agccgccgtgaccggtcaagggataggtcgcgcaataggtcaagggacaagtcacgagac
agatcccgagacaggtcaagagataggtcaagagataggtcaagagacaggtcaagagac
aggtcaaaggacaggtcacgagataagagagacaggtcccgcagtagagataagaccaat
gagagaaggagaaagtactcatcaggaagtgacagcagtgatagtgactga

DBGET integrated database retrieval system