KEGG   Candidatus Planktophila vernalis: A7sIIA15_01030Help
Entry
A7sIIA15_01030    CDS       T05319                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pvn  Candidatus Planktophila vernalis
Pathway
pvn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pvn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A7sIIA15_01030
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pvn03011]
    A7sIIA15_01030
Ribosome [BR:pvn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A7sIIA15_01030
  Bacteria
    A7sIIA15_01030
  Archaea
    A7sIIA15_01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 SpoIISB_antitox
Motif
Other DBs
NCBI-ProteinID: ASY20589
UniProt: A0A249KV60
Position
197003..197383
Genome map
AA seq 126 aa AA seqDB search
MIARAILRDIRHTPQKARRVVDLVRGMRADEALSVLKFAPQSAGSDVFTLLNSAVANAKA
QNPAIRDASELWVVEALVDEGRTMKRFRPRAQGRGFRILKRSSHISVAVSDVKAASKTMN
KKGATK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
ttgattgctcgcgcaattttgcgcgacattcgccacacaccacagaaggctcgtcgcgtt
gtcgacttggtccgtggaatgcgcgcagatgaagctctctcagttttgaagtttgctcca
caatcagctggttctgatgtgttcacacttcttaactctgcagttgctaatgcaaaagcg
cagaacccagctattcgtgatgcttcagaactttgggttgttgaagctctcgttgatgag
ggtcgcacaatgaagcgttttcgcccacgtgcacaaggtcgcggtttccgtatcttgaag
cgttcatcacacatctcagttgcagttagcgatgtaaaagccgctagcaagactatgaac
aagaagggagcgaccaagtaa

DBGET integrated database retrieval system