KEGG   Paenibacillus vortex: PVOR_00920Help
Entry
PVOR_00920        CDS       T05385                                 

Definition
(GenBank) ThiJ/PfpI domain protein
  KO
K18199  cyclohexyl-isocyanide hydratase [EC:4.2.1.103]
Organism
pvo  Paenibacillus vortex
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PVOR_00920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pvo01002]
    PVOR_00920
Enzymes [BR:pvo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.103  cyclohexyl-isocyanide hydratase
     PVOR_00920
Peptidases [BR:pvo01002]
 Cysteine Peptidases
  Family C56: PfpI endopeptidase family
   PVOR_00920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DJ-1_PfpI GATase GATase_3
Motif
Other DBs
NCBI-ProteinID: EFU43735
UniProt: A0A2R9T245
Position
189888..190487
AA seq 199 aa AA seqDB search
MKMAFILFHGMTALDLIGFTEVITRLSRIRPEAEVSWDYCAMTSHITDDRGLEYVIGRVK
PDLSKYELVFVPGGFATRKLRQDSEVIAWLQTAREAKYLVSVCTGSLLLGAAGLLEGKRA
TSNASAYDLLAPYCKEVVQARIVRDGRLITGGGVSSSIDLGLFMLERLTDAPTVELVKSD
MSYPYYQTGTSASVYHAMN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggctttcatcctgttccatggcatgacggctctggacctgatcggcttcacc
gaagtcataaccaggctctcccgcatccggccggaagcggaggtctcctgggattactgc
gcgatgacttcacacattaccgatgatcgcgggctggaatatgtgatcggccgggtaaag
cccgatctttccaagtatgagctggtttttgttcccggcggctttgccacgcggaagctg
cgacaggattccgaggtaatcgcatggctgcagacggcccgggaagcaaaatatctcgtt
tccgtctgcaccggatcactgctgcttggggcagccggtttgctggagggcaagcgagct
acctccaatgcttcggcttacgatcttttggcaccctactgcaaggaggtcgttcaagcg
cgcatcgtgcgggatggccgcctcattacaggcggaggggtatcttcatccattgatctc
ggcctcttcatgcttgaaaggttaaccgatgcgccaaccgtggagctcgtaaaatcggat
atgagctacccctactaccagacaggaacctcagcctcggtctatcacgccatgaattga

DBGET integrated database retrieval system