KEGG   Paenibacillus vortex: PVOR_03330Help
Entry
PVOR_03330        CDS       T05385                                 

Definition
(GenBank) Glucan endo-1,6-beta-glucosidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00511  Other glycan degradation
pvo00600  Sphingolipid metabolism
pvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PVOR_03330
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PVOR_03330
Enzymes [BR:pvo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PVOR_03330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_59 Glyco_hydro_30C Glyco_hydr_30_2 Phage_tail_X
Motif
Other DBs
NCBI-ProteinID: EFU43361
UniProt: A0A2R9T184
Position
99350..100696
AA seq 448 aa AA seqDB search
MSNITIHQSNGEEQLFVKKTKEQLAPVSPEAQQHTIVIDEEQTFQEMDGFGASFTDSAAY
LIHQVLETEQRSELMTQLFDANEGIGLSVLRQPMGASDYARDFYSYNDLPEGQSDEELKQ
FSIAHDEDDMIPLLQEALRLNPDVKLMGSPWSPPGWMKTSGSMIGGELKPEYYSVYANYF
VRYIQGYASHGLPIYAVTPQNEALYSPGHYPGMIMLPEAQSEFIKNHLKPQFVKNRINTK
ILCYDHNWDKPDYPMTVFEQAEDAVDGVAWHWYGGKPSAQSDVFEAFPGKEVHFTEGSGG
EWIPPFEQAFSNVMRTGIEILRNHSKSYVLWNMALDEKNGPTVPGFGKSTCRGIVTVNQQ
TKELTYTLDYYALAHFSKCVRPKALRVASTSNDLIRSVAFKNTDGSIAAVLFNDSEAPES
VAIQLRGEEALQLEMPAKSALTVMLANS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacatcacaatccaccagtcaaacggtgaagagcaattattcgttaagaaaacc
aaggagcagctggcgcccgtatccccggaggcacagcagcacacaattgttatcgatgag
gagcagacgtttcaggagatggatggctttggagcgtcctttacggattccgctgcttat
ctgattcatcaagtgctggagaccgagcagcgttcggagctcatgacacaattgttcgat
gccaacgaagggatcggtctgtcggtactgcggcaaccgatgggcgcgtctgattacgct
cgggatttctatagttataatgatctgccggaaggtcaatccgatgaggaactgaagcag
ttctccatcgcacacgatgaggatgatatgattccactgctgcaggaagcgctgcgattg
aatccggatgtgaagctgatgggctcgccttggagtcccccaggctggatgaagacgagc
ggctcgatgattggcggagagctgaagccggaatattattcggtgtatgcaaattatttt
gtgcgctatattcagggatatgcttcacacggtctcccgatttatgccgttaccccccaa
aatgaggcactgtattcacccgggcactatccgggcatgatcatgctgcctgaagcgcaa
agcgaattcatcaagaatcacttgaagccgcaattcgtgaagaaccggatcaacacaaaa
atcctctgttatgatcataactgggataagccggattacccgatgacggtgttcgagcaa
gcggaagatgcagtggatggtgttgcctggcactggtatggcggcaagccgtcggcccaa
tcggacgtattcgaagctttccctggcaaagaggtgcattttacggaagggtcgggcggg
gagtggattccgccgtttgagcaggccttctccaatgtgatgcggacgggtattgagatt
ctgcgcaatcatagtaagtcctatgtgctgtggaatatggccttggacgagaagaatggt
cctaccgtacctggctttggcaaaagcacctgccgcggcatcgtgaccgttaatcagcag
acaaaggagctaacgtatacgctggactattatgcgctggcacatttcagcaaatgtgtc
cgtccgaaagcgctgcgtgttgcttccaccagcaatgatctgatccgctctgttgccttc
aagaatacggatggttcaatcgcagccgtattgttcaacgacagcgaggcaccagagagc
gtggcgatccagctgcgcggggaagaggcattgcagctggagatgccggccaagagcgct
ctgactgtcatgctggcgaacagctag

DBGET integrated database retrieval system