KEGG   Paenibacillus vortex: PVOR_03360Help
Entry
PVOR_03360        CDS       T05385                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00450  Selenocompound metabolism
pvo00970  Aminoacyl-tRNA biosynthesis
pvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PVOR_03360
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PVOR_03360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pvo01007]
    PVOR_03360
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pvo03016]
    PVOR_03360
Enzymes [BR:pvo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PVOR_03360
Amino acid related enzymes [BR:pvo01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PVOR_03360
Transfer RNA biogenesis [BR:pvo03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PVOR_03360
 Prokaryotic type
   Other AARSs
    PVOR_03360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-ProteinID: EFU43367
UniProt: A0A2R9T1A9
Position
103497..105137
AA seq 546 aa AA seqDB search
MTNIFIGGAWPYANGSLHLGRLASLLPGDVLARYFRAKGEQVLYVSGSDCHGTPVAVQAI
QEGVTPRDIADRYHGEFAKCFEQLGFSYDLYTRTDQEFHHGVVQELFLKLLDNGYLYRKT
IQQTYCETDRRFLPDRYVEGDCPVCGSRARGDQCDVCSTLLDPSDLSNRACKICGNPPVE
RPTEHYYVSLSHFQAELTDDLNNAKGWRENAIQLTRRYLEEGLVDRAATRDLTWGVDVPV
PGFEDKKIYVWIEAVSGYLSASKQWAAETGGDWESFWLKEREDITAYYVHGKDNIPFHTL
IWPALLKGAGGLHVPDRIISCEYMTLEGKKFSTSRNWAIWVPDLLSRYQPDSIRYFLIAN
GPEKRDTDFSWREFIHSHNGELLGAFGNLVNRTLVFVNKSFDGKVPEGRITEEWQRRMES
LYREAGTLIEEGRLKEALELIFSTVRHANKYFDERKPWIQVKEDREACGDTLFTCVQIIA
NLTNLLQPFIPFSCDKIRGFLSLKPAAWNWCNVPAGERLHHVELLFERIDTSRIEEETRR
LEGLSF
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacatttttatcggcggtgcctggccttatgccaacggttccttacatttgggg
aggctcgcaagcttactgcccggtgacgtgttagcgcgttatttccgcgcaaagggagag
caggtgttgtatgtgtccggcagcgattgccatggtacgccggtggcggtgcaggcgatt
caagagggggtaacgcctcgggatattgcggatcggtatcatggagagtttgcgaaatgc
ttcgaacagctgggtttttcctacgatttgtatacgcgaaccgaccaggaatttcatcat
ggcgtggttcaggagctgtttctgaagctgctggataacggctatctgtatcggaaaacg
atccagcagacgtattgcgagaccgatcggcggtttctgccggaccgttatgtggaagga
gactgtccggtatgcggcagcagggctcgcggtgaccagtgcgacgtctgttcaacccta
ctggatccgtcggatctgagtaacagagcctgcaaaatctgcggcaacccgccagtagaa
cggccaaccgagcattattatgtttcgctgtcgcattttcaagcagagctcaccgatgac
ctgaataacgccaagggctggcgggagaatgcgatccagctgacgcgaagatatctggag
gaagggcttgtggaccgggcggcgacgagggatctcacttggggagtggatgtacccgtc
cctggcttcgaggataagaaaatctatgtatggattgaggcggtgagcggctatctatcc
gccagcaagcagtgggccgcggaaacgggcggcgattgggagtccttttggctgaaagag
agggaggatataacagcttattatgttcatgggaaagacaatatcccgtttcacacattg
atctggccagcgctgcttaagggtgccggaggactgcatgtgccggatcggatcatttct
tgtgagtacatgacgctggaagggaagaagttctcgaccagtcggaactgggcgatctgg
gtaccggatttgctaagtcgctatcagccggattcgatccgctacttcctcattgcgaac
ggtcccgagaagcgggataccgatttttcctggcgggagttcattcatagccataatggc
gagctgcttggagcttttgggaatctcgtgaatcgaactttggtgtttgtgaacaaatcg
tttgacgggaaggtacccgaagggcgcataactgaagagtggcagagacgtatggagtca
ttgtaccgggaggccggaacgctcatcgaagaggggcgattgaaggaggcgctggaatta
atttttagtacggtacgtcatgcgaacaaatattttgatgagcgcaagccatggattcag
gtcaaggaggatcgcgaagcttgcggggataccctcttcacctgtgttcagatcatcgct
aacctgacgaatctgctgcagccgtttatcccgttttcctgtgacaaaataagaggcttt
ctctcgttgaagccagcagcgtggaattggtgcaatgttccggctggcgagcgccttcat
cacgtggagctcttgtttgaacgtatcgatacaagccggattgaggaggagacccgcagg
ctggaggggttgtccttctga

DBGET integrated database retrieval system