KEGG   Paenibacillus vortex: PVOR_03998Help
Entry
PVOR_03998        CDS       T05385                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
pvo  Paenibacillus vortex
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PVOR_03998
Enzymes [BR:pvo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     PVOR_03998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHP_C PHP DUF3416
Motif
Other DBs
NCBI-ProteinID: EFU43230
UniProt: A0A2R9T126
Position
complement(31214..31990)
AA seq 258 aa AA seqDB search
MKIDLHTHAKLSKASDFSQTYYEEMVREAMDNGLHALALTEHFNTRNFDEVYQQLDRMFP
YNGEYYDAGGLKIFPGMEVDIRETGHILLIGRKEFILETRRQLNDYTEKGAFIPFDDLMD
LAEALPLLKIGAHPFRESTPLHHLDHSQLQRLDAFDLNAKDMYQYGCEANQDQVQRFAAK
LGKPVTAGSDTHQCLQYGSVYNELDMPCETVAELKHAILQGAYRLHVSDSLPLQVKASVM
LKKLMKQIIRLETAPGIV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatctgcacacccatgccaaattgtccaaggcatcagacttctcacagacc
tactatgaagagatggtccgcgaagccatggataacgggctgcatgcactcgcgctcacc
gagcattttaacacacgcaacttcgacgaggtgtaccagcagctggaccggatgtttcct
tacaatggcgagtattatgatgcaggcggtttaaaaatattccccggcatggaagtcgac
attcgggagaccggccacattctgctcatcggacggaaggagttcattctggaaacccgc
cgccagttgaacgattatacggagaagggtgcttttattccctttgatgatctgatggat
ctggccgaagccctgccactgctcaaaatcggagcccatccgttccgggagagcacgcca
ctccatcatttggaccacagccagctccagcgtctggatgcctttgatctcaatgccaag
gacatgtaccaatacggctgtgaggccaatcaggatcaggtccagcgttttgccgccaaa
ctcggcaagccggtgacggcgggcagcgatactcatcaatgcctgcagtatggaagtgtc
tacaacgagctggatatgccctgtgaaactgttgccgagctgaagcacgcgattcttcag
ggtgcttaccggcttcatgtctcggatagcctccctcttcaggtcaaggcgtccgtcatg
ctaaaaaagctgatgaaacaaatcatccgactcgagacagctccaggcatcgtataa

DBGET integrated database retrieval system