KEGG   Paenibacillus vortex: PVOR_14619Help
Entry
PVOR_14619        CDS       T05385                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00670  One carbon pool by folate
pvo00790  Folate biosynthesis
pvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PVOR_14619
   00670 One carbon pool by folate
    PVOR_14619
Enzymes [BR:pvo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PVOR_14619
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: EFU41278
UniProt: A0A2R9SV66
Position
18835..19329
AA seq 164 aa AA seqDB search
MISMIWAMGKDQVIGLNGTMPWRLPRDMAFFREKTLNKTILMGRKTWESFGSKPLPHRTN
IVLTRDENFTLSEDQGIVLHDIEDATAYSNNGELMVIGGAQIYEKMLPKADRLYCTFIDE
SFEGDTYFPEVDWDQWQIIEEIPGITDEKNPYTYRFVIYERKHK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgatatccatgatatgggcaatgggcaaggatcaggtgattggcttaaacggaacaatg
ccgtggcgtttgccgcgggatatggcttttttcagggagaaaaccttgaacaaaacgatt
ctgatggggcgtaaaacctgggaatcttttggcagtaaaccgctgccgcacagaacgaac
attgtgcttaccagggacgagaattttacgctgtcggaggatcaagggatcgttcttcac
gatatcgaggatgctacggcttattcgaacaacggagaattaatggtgattggcggagca
caaatctacgagaagatgctgcccaaggcagatcgtctgtattgcacgttcattgacgag
tcttttgaaggggatacttacttcccggaggtggactgggatcaatggcagattattgaa
gaaatcccgggtattacagatgagaaaaatccatacacttaccggtttgttatttatgag
cgaaaacacaagtag

DBGET integrated database retrieval system