KEGG   Paenibacillus vortex: PVOR_26935Help
Entry
PVOR_26935        CDS       T05385                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PVOR_26935
Enzymes [BR:pvo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     PVOR_26935
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     PVOR_26935
    1.1.1.-  
     PVOR_26935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C ADH_N_assoc Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: EFU38949
UniProt: A0A2R9SNL3
Position
complement(35454..36503)
AA seq 349 aa AA seqDB search
MQALRWHGVKDLRLETIAEPQATNGKVKIKVEWCGICGSDLHEYVAGPIFIPENTPHTLT
GEQAPVVMGHEFSGQVVEVGEGVTKFKAGDRVVVEPVFSCGTCDACRQGKYNLCEEMGFL
GLAGGGGGFSEYVAADEHMVHKIPDGVSYEQGALVEPAAVALYAVRQSQLKAGDRAVVFG
AGPIGLLVIEALKAAGASEIYAVELSPERKQKAEELGAIVLDPKAHAVVDELHRRTGGGV
DVAFEVTGVPPVLSQAINSTKIGGQIMIVSIFETSAPIVPNDVVMKERNITGIIGYRDVF
PAVISLMEKGFFPADKLVTQRIKLDEVIDRGFEALLKEKNQVKILVSAH
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcattgcgctggcatggcgtgaaggatctgcgtttggagacgatagcggagcct
caagcaacgaatggaaaagtgaaaatcaaggttgaatggtgcggcatttgtggcagtgat
ctccatgaatacgtggccgggcctatatttatacctgagaatacacctcatacgcttaca
ggagaacaggctcccgtcgttatgggccatgaattttccggccaggtggtagaggttggc
gaaggcgttacgaaattcaaggctggtgaccgagtggtcgttgagcctgtattttcatgc
ggaacatgcgacgcttgccgacaagggaaatataatctatgcgaagaaatgggctttctt
gggcttgccggcggtggcggcggattctccgaatatgtggcagccgatgagcatatggtt
cataaaattccagatggtgtctcttatgaacagggagccttggtagaacctgcggcggtc
gcgctgtatgccgtgcgccaaagtcagctgaaagccggggatcgagctgtggtcttcgga
gccgggcctatcggtctgcttgtgatcgaagcattgaaggcagcaggcgcttctgaaatc
tacgcggtggagctgtccccggagcggaaacagaaagccgaggagttgggtgccattgtg
ttggatccgaaagcccacgctgtggtggatgagcttcatcgccgcaccggtggtggagtc
gatgtggcattcgaggttacgggtgtccctcctgtactgagccaagcgatcaactccacg
aagatcggcggacagattatgattgtcagcatattcgaaacctctgcgccaatcgttccg
aatgatgtcgtgatgaaggagcggaatattaccggaatcatcggttatcgtgacgtattc
ccggctgtcattagcctgatggaaaaaggcttcttcccggcagataagctggtaacccag
cggatcaaactggacgaggtgattgaccggggctttgaggccctgctcaaagagaagaac
caggtgaaaatcctggtaagtgctcactaa

DBGET integrated database retrieval system