KEGG   Paenibacillus vortex: PVOR_30228Help
Entry
PVOR_30228        CDS       T05385                                 

Definition
(GenBank) O-acetylhomoserine aminocarboxypropyltransferase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
pvo  Paenibacillus vortex
Pathway
pvo00270  Cysteine and methionine metabolism
pvo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PVOR_30228
Enzymes [BR:pvo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     PVOR_30228
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 GDC-P Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: EFU38372
UniProt: A0A2R9SLY2
Position
complement(61394..62686)
AA seq 430 aa AA seqDB search
MSEERQFSIETLAVHAGQELDPTTLSRAVPLYQTTSYGFKDSEHAANLFALKEFGNIYTR
IMNPTTDVFEKRIAALEGGAGALATSSGQAAITFSVLNIAGAGDEIVSSSSLYGGTYNLF
SNTLAKLGIKVHFVDSTDPENFRKAINGKTKALFAETIGNPQGNVLDVEAVAAIAHENGI
PLIVDNTFPSPYLLRPIEFGADIVVHSATKFIGGHGTSIGGVIVDSGKFDWTANDKFPGL
TEPDPSYHGVVYTEAVGPIAYIIKARVQLLRDIGASLSPFNSWLLLQGLETLHLRVERHS
KNALKVAKYLESHEAVEWVSYAGLPSHPSYELAQKYLPKGQGAILTFGIKGGAEAGQKVI
ENVKLFSHLANVGDSKSLIIHPASTTHQQLTEDEQLTAGVNPELLRLSIGTESIDDILYD
LEQAIAASQK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagaacgccaattttccattgaaaccttagcggttcatgccggtcaggagctt
gatccgaccaccttatcacgtgctgtgcctctgtatcagacgacttcctacgggtttaaa
gacagtgagcatgcggctaatctgttcgcactaaaagaattcggcaatatttacacacgt
attatgaacccgaccacggacgtgtttgagaagcggattgcggcgcttgaaggcggtgcc
ggtgcactggcgacatcttccgggcaggcagcgattacgttctctgttctgaacatagcg
ggtgccggtgatgaaattgtttcctcctccagtttgtatggcggcacatataatttattt
tccaatacgctggcgaagctgggcatcaaggtgcactttgtggattccacggatccggag
aatttccgtaaggccatcaatggcaagaccaaggcattgtttgcagaaacgattggcaat
ccgcaaggaaacgtgctggacgtggaagccgtggctgccattgcgcacgagaacggtatt
ccgctgattgtggataataccttcccaagcccgtacttgctgcgtccgattgaatttgga
gcggatatcgttgttcattcggccaccaaatttattggcggtcacggtacttccatcggc
ggggttattgttgatagcggtaaattcgattggacggcaaacgacaagttccctgggctt
acggagccggacccaagctatcatggcgttgtgtatacggaggccgtaggcccgatcgct
tatattattaaagcgcgtgtccagctgctgcgggatatcggcgcatccctctccccattt
aattcctggctgctgctgcaaggtttggaaacactgcatcttcgcgttgagcggcatagc
aagaatgcgctgaaggttgccaagtatttggagagtcacgaggcggtggaatgggtgagc
tatgcagggctgccgagtcatccgtcatacgagctggcgcagaagtacctgccaaagggc
caaggcgccattctgaccttcggtatcaagggtggagctgaagcagggcagaaggtgatc
gagaatgtgaagctgttctcccaccttgccaacgttggcgactccaagtctcttattatt
catccggccagcaccacgcaccaacagctgaccgaagacgagcagctgacagcgggcgtg
aatccggaactgctgcgtctgtccatcggaaccgaatccattgacgatattctttatgat
ctggagcaagccattgcggcaagccagaagtag

DBGET integrated database retrieval system