KEGG   Pseudomonas veronii: PverR02_06770Help
Entry
PverR02_06770     CDS       T04853                                 

Definition
(GenBank) amino acid ABC transporter permease
  KO
K10016  histidine transport system permease protein
Organism
pvr  Pseudomonas veronii
Pathway
pvr02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PverR02_06770
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pvr02000]
    PverR02_06770
Transporters [BR:pvr02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    PverR02_06770
   Histidine transporter
    PverR02_06770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Holin_9 DUF1516
Motif
Other DBs
NCBI-ProteinID: AQY64772
Position
complement(1509306..1510034)
Genome map
AA seq 242 aa AA seqDB search
MFEELLQTLGLSAFSLKGFGPLLLQGTWMTLKLSVLSLAVSVLLGLLGASAKLSSLPFLR
IPAQLYTTLIRGVPDLVLMLLIFYSLQTWLTGLTDFMEWEYIEIDPFSAGVITLGFIYGA
YFTETFRGAILAVPRGQLEAATAYGLKRGQRFRYVTFPQMMRFALPGIGNNWMVMLKATA
LVSIIGLADLVKAAQDAGKSTYQLFYFLVIAALIYLLITSASNFVLRRLERRYSAGSREA
VR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaagaactgttgcaaaccctcgggctgagcgcgttcagtttgaagggtttcggc
ccgctgttgctgcaaggcacctggatgaccctcaagttgtcggtgctgtccctggccgtc
agcgtgttgctgggcctgctcggcgccagcgccaaactgtccagcctgccgttcctgcgc
attcccgcccagctctacaccacgttgattcgtggcgtgcccgacctggtgctgatgctg
ctgattttctacagcctgcaaacctggctgaccggtcttaccgacttcatggaatgggaa
tacatcgaaatcgacccattcagcgccggggtgatcaccctgggctttatttacggtgcg
tacttcaccgaaacctttcgcggcgcgatcctcgcggtgccccgtggtcaactggaagcc
gccacggcttacggcctcaagcgcgggcagcggtttcgctacgtgaccttcccgcaaatg
atgcgctttgccctgccgggcatcggcaacaactggatggtaatgctcaaggccaccgca
ctggtgtcgatcatcggcctcgcggatctggtcaaggccgcgcaggacgccggcaagagc
acctatcagctgttttacttcctagtgatcgccgcattgatctacctgctgatcaccagt
gcgtccaactttgtcctgcgccgtcttgaacgtcgctattcggcaggctcgcgggaggcc
gtgcgatga

DBGET integrated database retrieval system