KEGG   Pseudomonas veronii: PverR02_10825Help
Entry
PverR02_10825     CDS       T04853                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00071  Fatty acid degradation
pvr00072  Synthesis and degradation of ketone bodies
pvr00280  Valine, leucine and isoleucine degradation
pvr00310  Lysine degradation
pvr00362  Benzoate degradation
pvr00380  Tryptophan metabolism
pvr00620  Pyruvate metabolism
pvr00630  Glyoxylate and dicarboxylate metabolism
pvr00640  Propanoate metabolism
pvr00650  Butanoate metabolism
pvr00900  Terpenoid backbone biosynthesis
pvr01100  Metabolic pathways
pvr01110  Biosynthesis of secondary metabolites
pvr01120  Microbial metabolism in diverse environments
pvr01130  Biosynthesis of antibiotics
pvr01200  Carbon metabolism
pvr01212  Fatty acid metabolism
pvr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pvr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PverR02_10825
   00630 Glyoxylate and dicarboxylate metabolism
    PverR02_10825
   00640 Propanoate metabolism
    PverR02_10825
   00650 Butanoate metabolism
    PverR02_10825
  Lipid metabolism
   00071 Fatty acid degradation
    PverR02_10825
   00072 Synthesis and degradation of ketone bodies
    PverR02_10825
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PverR02_10825
   00310 Lysine degradation
    PverR02_10825
   00380 Tryptophan metabolism
    PverR02_10825
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PverR02_10825
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PverR02_10825
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PverR02_10825
Enzymes [BR:pvr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PverR02_10825
Exosome [BR:pvr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PverR02_10825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AQY65534
Position
complement(2342452..2343633)
Genome map
AA seq 393 aa AA seqDB search
MQDVVIVAATRTAVGSFQGSLASVPAPELGAAVIRRLLEQTGLDPAQVDEVILGHVLTAG
SGQNPARQASILAGLPHAVPAMTLNKVCGSGLKALHLGAQAIRCGDADVIIAGGMENMSL
APYVLPGARTGLRMGHAKMIDSMITDGLWDAFNDYHMGITAENLVDKYGISREAQDAFAA
ASQQKAAAAIEAGRFADEITPILIPQRKGDPVAFAVDEQPRAGTTAESLAKLKPAFKKDG
SVTAGNASSLNDGAAAVLLMSADKAKALGLPVLARIASYANAGVDPAIMGIGPVAATRRC
LDKAGWSVGDLDLVEANEAFAAQSLAVAKELEWDADKVNVNGGAIAIGHPIGASGCRILV
TLLHEMIKRDAKKGLATLCIGGGQGVALALERS
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgttgtgattgttgctgccacacgtaccgccgtaggcagttttcaaggatcg
ctcgcgagcgtcccggcaccggagttgggcgctgccgtaatccgtcgcctgctggagcag
accggcctcgacccggcccaggtggatgaagtgatcctcggccacgtactcaccgcaggc
tcaggccagaacccggcgcgccaggcgtcgatcctcgccggcttgccccatgccgtaccc
gcgatgaccttgaacaaggtctgcggttcgggcctcaaggccctgcacctgggcgcccag
gccatccgttgtggcgatgccgacgtgatcatcgccggcggcatggagaacatgagcctg
gccccctacgtattacctggtgcgcgcaccggtttgcgcatgggccacgccaagatgatc
gacagcatgatcaccgacggcctgtgggatgcattcaacgactaccacatgggcatcacc
gccgagaacctggtggacaagtacggcatcagccgtgaagcccaggacgccttcgccgcc
gcgtcccagcaaaaagccgccgccgccatcgaagccggccgctttgccgatgagatcacg
ccgattctgatcccgcagcgcaagggcgacccggtggccttcgccgtggatgaacaaccg
cgcgccggcaccaccgccgagtcgttggccaaactcaaacccgcgttcaagaaagacggc
agcgtcaccgcgggcaacgcgtccagcctcaacgacggcgccgccgcggtgctgctgatg
agcgccgacaaggccaaggcccttggcctgcccgttctggcgcgtatcgccagctacgcc
aatgccggcgtcgacccggccatcatgggcatcggcccggtcgcggccacccgccgctgc
ctggacaaagccggctggagcgtcggcgacctggacctggtcgaagccaacgaagccttt
gccgcgcaatccctggcggtggccaaagagctggaatgggacgccgacaaagtcaacgtc
aacggcggcgcgattgccattggccacccgatcggcgcatcaggctgccgcatactggtg
accctgctgcacgaaatgatcaagcgcgacgccaaaaaaggcctggcgacactgtgcatc
ggtggcggccaaggcgtagccctggcccttgagcgcagctga

DBGET integrated database retrieval system