KEGG   Pseudomonas veronii: PverR02_12690Help
Entry
PverR02_12690     CDS       T04853                                 

Definition
(GenBank) aldehyde dehydrogenase (NADP(+))
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00040  Pentose and glucuronate interconversions
pvr00053  Ascorbate and aldarate metabolism
pvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PverR02_12690
   00053 Ascorbate and aldarate metabolism
    PverR02_12690
Enzymes [BR:pvr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     PverR02_12690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQY65863
UniProt: A0A0R2ZWD6
Position
2743592..2745172
Genome map
AA seq 526 aa AA seqDB search
MPQFLGHNYIGGQRSANGSLKLQSVDAATGEALPQDFYQATPQEVDAAAKAAAAAYPAYR
ALSASRRAQFLDAIADELDALGDAFVELVCRETALPAARIKGERGRTSGQMRLFATVLRR
GDFYGARIDKALPDRQPLPRPDLRQYRIGLGPVAVFGASNFPLAFSTAGGDTAAALAAGC
PVVFKAHSGHMATAERVADAIIRAAETTEMPAGVFNMIFGGGVGEALVKHPAIQAVGFTG
SLKGGRALCDMAAARPQPIPVFAEMSSINPVIVLPQALQARAETVARELTASVVQGCGQF
CTNPGLVIGLASPAFSAFTQQVAQLIGDQPAQTMLNAGTLSSYDKGLQKLLAHPGIQHLA
GQAQAGHQARPQLFKADVSLLIDGDEVLQEEVFGPTTVFVEVADQAQLSAALHGLHGQLT
ATIIGEPADLQQFAELTPLLEQKVGRILLNGYPTGVEVCDAMVHGGPYPATSDARGTSVG
SLAIDRFLRPVCFQNYPDSLLPDALKNANPLRIQRLVDGTPSRDSL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagttccttggtcacaactacatcggcggccagcgcagcgccaacggcagcctc
aagctgcagagcgtcgatgcggcgaccggcgaagccttgccccaggatttctaccaggcg
accccgcaggaagtcgacgccgccgccaaggccgcggcagcggcttacccggcgtaccgc
gccttgagtgcgtcgcgccgcgcgcagttccttgacgcgatcgccgatgagctggacgcg
ctgggcgatgccttcgtcgaactggtctgccgtgaaaccgcgctgcccgctgcgcgtatc
aaaggcgagcgcggccgcaccagcgggcagatgcggctgttcgccacggtgttgcgtcgc
ggcgatttctacggcgcgcgcatcgacaaggcactgccggatcgccagccgctgccacgc
ccggacctgcgccagtaccgcatcggcctgggcccggttgcggtgtttggcgcgagcaac
ttccccctggcgttttccacggcgggcggggataccgccgccgcgctggcggccggctgc
ccggtggtgttcaaggcccacagtgggcatatggccacggccgagcgcgtcgccgatgcg
atcattcgcgcggccgagaccaccgagatgccggcgggcgtgttcaacatgatctttggt
ggcggcgtcggtgaagcgctggtcaagcacccggcgatccaggcagtcggctttaccggc
tcgctcaagggcgggcgcgccctgtgcgacatggcggcggcgcgtccgcagccgatcccg
gtattcgccgagatgtcgagcatcaacccggtcatcgtgttgccccaggccctgcaggcg
cgggccgaaaccgtggcacgcgagctgactgcctcggtggtgcaaggctgcggccagttc
tgtaccaaccccggtctggtgatcggcctcgcgtcgccggccttcagcgcgttcacccag
caggtcgcgcaactgatcggcgatcagccggcgcagaccatgctcaatgccggcaccttg
agcagctatgacaagggcctgcaaaaactgctggcgcaccccggcatccaacacctggcc
ggtcaggctcaagccgggcatcaggcgcggccgcagttgttcaaggccgatgtcagcctg
ctgatcgacggcgatgaagtgctgcaagaggaagtgttcggccccaccacggtgttcgtt
gaagtcgccgaccaggcccagctcagcgccgccttgcatggcctgcacggccagctcacg
gcgacgatcatcggcgagccggccgacctgcaacagttcgccgaactcacgccgctgctg
gagcagaaagtcgggcgtatcctgctcaacggttacccgaccggcgtggaagtctgcgat
gcgatggtgcatggcgggccgtacccggcgacgtcggatgcgcgtggcacctcggtcggc
agcctggccatcgaccgcttcctgcgcccggtgtgtttccagaactacccggacagcctg
ctgcccgacgcgttgaaaaacgccaacccgttgcgtatccagcgcctggtggatggcaca
ccgtcacgcgactcgctgtaa

DBGET integrated database retrieval system