KEGG   Pseudomonas veronii: PverR02_14290Help
Entry
PverR02_14290     CDS       T04853                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00450  Selenocompound metabolism
pvr00970  Aminoacyl-tRNA biosynthesis
pvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    PverR02_14290
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PverR02_14290
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pvr01007]
    PverR02_14290
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pvr03016]
    PverR02_14290
Enzymes [BR:pvr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     PverR02_14290
Amino acid related enzymes [BR:pvr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PverR02_14290
Transfer RNA biogenesis [BR:pvr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PverR02_14290
 Prokaryotic type
   Other AARSs
    PverR02_14290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1e tRNA-synt_1 Anticodon_1 tRNA-synt_1f CFC Laminin_EGF
Motif
Other DBs
NCBI-ProteinID: AQY69467
Position
3128912..3130501
Genome map
AA seq 529 aa AA seqDB search
MPIPPTPNGRLHLGHIAGPYLRMDMLGRYLRSQGHRVDVVSAVDGFDSYVLWKALQEQRT
PEAVVRDYHGQIAHDLRALDVEVDDFLDLVQGPYAQQHARNAQRTVERLVALGVTQSVVE
RVLYCPDTRRYMAGAWLLGQCPYCRAGAGGYFCEACGALFRPEAMLDPQPRMGDSPLHWV
EVESLFLTVAHPEQLLQRMATSGAPASIVEVIARFLERENGRVRLTAPGEWGVAWSPDRF
GNPRVLFESGWEYALTCADRSQEQAPEHGHAMLRSSEVTTLVSFGIDNAVLLLAGSVAVM
DALQDHRSFDYVLTNYFYNLQGAKFSTSRLHVVWAADIVEKTPATSDAVRYFLSRESPEQ
GETNFAVEEFVEVVNVDLAGALDGRIDLALAALDHTRPQSIAPALWPALELAVTRLGQAF
RLDAVSVREAWDVLHQWMQRPDLDVTQPAHAYLWLKGLAYLAAPIMPRLAEYLWQRLGHD
GLPLIQALHAASQPRPQTSARPRFAPLSPAALAPCLPASVVLAGATSDA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcccgccgactccgaacggcaggctgcacctggggcatatcgccgggccgtac
ttgcgcatggacatgctggggcgctacctgcgcagccagggccatcgtgtcgacgtggtc
tcggcggtcgacggcttcgactcctatgtgctgtggaaggccctgcaagagcagcgcacg
cccgaagccgtggtgcgcgactatcacgggcaaatcgcccatgacctgcgcgcgctggat
gtcgaggtggatgacttcctcgatctggtgcaaggcccctatgcgcagcagcatgcgcgc
aatgcccagcgcacggtggagcgcctggtggcgctcggggtgacgcaaagcgtggtcgaa
cgcgtgctgtattgcccggacacccggcgctacatggcgggggcctggctgctggggcaa
tgcccgtattgccgggcgggggcgggcggctatttttgcgaagcctgcggcgcactgttt
cgcccggaagccatgcttgacccgcaaccgcgcatgggcgacagccccctgcactgggtt
gaggtcgaaagcctgtttctgaccgtcgcccaccccgagcagttgctgcagcgcatggcg
acctccggtgcgccggcgtcgatcgtcgaggtgattgcgcgcttcctggaacgggaaaac
ggccgggtgcggctgaccgcgccgggcgaatggggcgttgcctggagcccggaccgcttc
ggcaacccgcgcgtgctgttcgaatcgggctgggagtatgcgctgacctgcgccgaccga
tcccaggaacaggcgcccgagcacggccatgccatgctgcgcagcagcgaggtgacgacg
ctggtcagttttggcatcgacaacgcggtgctgctgttggccggcagtgtcgcggtgatg
gatgcgttgcaggatcaccgctcattcgattacgtgttgaccaattacttctacaacctg
caaggcgcgaagttttccaccagccgcctgcatgtggtgtgggccgccgatatcgtcgaa
aagaccccggcgaccagcgacgcggtgcgttacttcctgagccgcgaaagccccgaacag
ggcgaaaccaacttcgccgtggaggagtttgtcgaggtggtcaatgtggacctggccggt
gcgctcgacggtcgcatcgacctggcgctggccgccctcgatcacacgcggccgcagtcc
atcgccccggcgctgtggccggccctggagctggccgttacgcggttggggcaggccttc
cggttggacgcggtgtcggtgcgcgaagcctgggacgtgctgcatcaatggatgcaacgc
cccgacctggacgtcacgcagcccgcccacgcctacctgtggctcaagggcctggcgtac
ctggccgcgccgatcatgccgcgcctggccgagtacctgtggcagcgcctggggcatgac
ggtttgccgctgatccaggcgctgcacgctgcctcgcagccacgtccgcagacctcggcg
cgcccgcgctttgcgccgctgtcgccggccgcattggcgccgtgcctgccggccagcgtg
gtgcttgccggggccaccagcgatgcatga

DBGET integrated database retrieval system