KEGG   Pseudomonas veronii: PverR02_26330Help
Entry
PverR02_26330     CDS       T04853                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pvr  Pseudomonas veronii
Pathway
pvr00480  Glutathione metabolism
pvr00590  Arachidonic acid metabolism
pvr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pvr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    PverR02_26330
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PverR02_26330
Enzymes [BR:pvr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PverR02_26330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: AQY68418
UniProt: A0A0R3AK19
Position
complement(5765924..5766406)
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLKALDGQELPLAPFKGKVVLVVNVASKCGLTPQYAALENLYQQYKDQGFTVL
GLPCNQFAGQEPGTEKDIQEFCSLNYGVSFPLGSKLDVNGPERHQLYRLLAGEGAEFPGD
ITWNFEKFLLGKDGRVLARFSPRTAPDDPAVVQAIEKALS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttccacgacctgaaactcaaagcgttggacggacaagagctgccactggcg
cccttcaagggcaaagttgtgctggtggtcaacgtggcctccaaatgtggcttgaccccg
caatacgcggcgttggaaaacctctatcagcagtacaaggaccaggggtttaccgtactc
ggcctgccctgcaaccagtttgcgggccaggaaccggggaccgagaaagacatccaggaa
ttctgcagcctcaattacggggtgagctttccgctgggcagtaaactcgatgtgaacggc
cctgagcgtcaccagttgtaccgcttattggcgggcgagggcgccgagttccccggggac
atcacctggaacttcgagaaatttctgctgggcaaagacgggcgggtgcttgcgcgtttc
tcgccgcgaacggcaccggatgatccggccgtcgtccaggccatcgaaaaagccctgagc
tga

DBGET integrated database retrieval system