KEGG   Candidatus Planktophila versatilis: A1sIA79_05570Help
Entry
A1sIA79_05570     CDS       T05250                                 

Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pvs  Candidatus Planktophila versatilis
Pathway
pvs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pvs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A1sIA79_05570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pvs03011]
    A1sIA79_05570
Ribosome [BR:pvs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A1sIA79_05570
  Bacteria
    A1sIA79_05570
  Archaea
    A1sIA79_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 CDPS
Motif
Other DBs
NCBI-ProteinID: ASY17667
UniProt: A0A249KQD7
Position
complement(1084220..1084711)
Genome map
AA seq 163 aa AA seqDB search
MPNTQDALIARAVLRDIRHTPQKARRVVDLVRGMRADEALNVLKFAPQAAGSDVYTLLNS
AIANAKQQNPAIRDASELWVVEALVDEGRTMKRFRPRAQGRGFRILKRSSHISVTVSDSK
VTSKSLSRTSTKAQTRNPKRSEKSPLAAPVAAVPTPAAKGASN
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgcctaatacacaagacgcactcatcgctcgcgcagtactgcgcgacatccgccacaca
ccacagaaggctcgtcgcgttgtcgacttggtccgtggaatgcgtgcagatgaagcactt
aacgttcttaagtttgctccgcaagcagctggttcagatgtgtacacacttcttaactca
gcaattgctaatgctaagcagcagaatccagcaatccgcgatgcttcagagctctgggtt
gttgaagcacttgttgacgagggacgcacaatgaagcgttttcgcccacgtgcacaagga
cgaggtttccgtatcttgaagcgctcaagccacatctctgtgactgtcagcgattcaaag
gtgacttcaaagtcactttcacgtacttcaacaaaggcgcagacaagaaatccaaagcgt
tctgagaagtcaccacttgctgctccagtagcagcagttccaacaccagcagcgaaggga
gcgtccaactaa

DBGET integrated database retrieval system