KEGG   Pogona vitticeps (central bearded dragon): 110069861
Entry
110069861         CDS       T05000                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pvt  Pogona vitticeps (central bearded dragon)
Pathway
pvt00100  Steroid biosynthesis
pvt01100  Metabolic pathways
Module
pvt_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110069861 (TM7SF2)
Enzymes [BR:pvt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     110069861 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 110069861
NCBI-ProteinID: XP_020633092
UniProt: A0A6J0SA37
Position
Unknown
AA seq 421 aa
MMMDRLKVPRTKELEFGGVIGAAFLILFLPATVFYLLLVCQTEQASLLSFPRPLPTFRSL
WSPQDLALVLAWIGLQAGLYMLPMGKVTEGIALRDKSRLQYQVNGSHAMVVTALVVGAGL
GAGLRLSYIYDHFLQLAFSATLVSFGLSILLYFKSLLAPETALAPGGNSGNPIYDFFMGH
ELNPRLGSFDLKFFCELRPGLLGWALINMAMLVKETELRGNPSLAMILVNGFQLLYVVDA
FWHEEAILTTMDIVHDGFGFMLAFGDLTWVPFLYSLQSYFLVTHPQKLSLSMAGGIILLN
GLGYSIFRGANSQKNTFRRNPADPKVAGLRTIPTATGRRLLVSGWWGFVRHPNYLGDLIM
AFAWSLPCGLTHILPYFYVIYFTFLLVHREARDERQCLRKYGLAWQEYCRRVPYRIFPYL
Y
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgatgatggatcgactcaaggtcccacggacgaaggagctggaatttgggggcgtcata
ggggctgccttcctgatcctctttctgcctgccacggtcttctacctcctcttggtctgc
cagactgagcaggccagcctcctcagctttcctcggcctttgcccactttccggtccttg
tggagcccccaagatttggccctcgtcttggcctggataggattgcaagcagggctctat
atgctacccatggggaaggtgacagaagggatcgctctccgagacaaaagtcggctccag
taccaagttaacgggtcccacgccatggtggtcactgccctggtggtcggggctggcttg
ggggcaggcctccgcctcagctacatctatgaccatttcctgcagctcgccttctcggcc
accttggtctctttcgggctgagcatcctcctctacttcaagtccttgctggcccctgag
acggcgctggctccgggtgggaattcaggaaatcccatttacgacttcttcatgggccac
gagttgaacccgcgcctcggttcctttgacctcaagttcttctgtgagctgcgcccgggt
ctcctcggctgggccctgattaacatggccatgttagtgaaggagacggagctaagaggc
aacccttccttagccatgatcctggtgaacggcttccagcttctctacgtggtggacgct
ttctggcacgaggaggccatcctcacgaccatggacatcgtccatgacggttttggtttt
atgctggctttcggggacctgacgtgggtcccgttcctgtacagtctccagagctatttt
ctggtcacccacccacagaagctgagcctttccatggctggaggcatcatcctactcaac
ggtcttggttattccatcttccgtggagcgaattcccagaaaaacaccttccgtcggaat
cctgctgaccccaaagtggctggactgaggaccatccccaccgccaccggacggcgtctc
ctggtctcgggctggtggggtttcgtccggcaccccaactacttaggcgacctcatcatg
gctttcgcatggtccttaccctgcgggctcacccacatcctcccctatttctacgtgatc
tactttaccttcctcctggttcaccgggaggcccgcgacgagcgccagtgcctgaggaag
tacggcttggcctggcaggaatattgccggcgagttccctatcggatcttcccgtacctt
tactga

DBGET integrated database retrieval system