KEGG   Pogona vitticeps (central bearded dragon): 110070316Help
Entry
110070316         CDS       T05000                                 

Definition
(RefSeq) erlin-1-like
  KO
K23341  erlin
Organism
pvt  Pogona vitticeps (central bearded dragon)
Brite
KEGG Orthology (KO) [BR:pvt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pvt04121]
    110070316
Ubiquitin system [BR:pvt04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    110070316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 110070316
NCBI-ProteinID: XP_020633649
Position
Unknown
AA seq 291 aa AA seqDB search
MLPFITTYRAVQTTLHTDEVKNIPCGTSGGVMIYIDRIEVVNMLAAHAVYDIVRNYTADY
DKALIFNKIHHELNQFCSVHTLQEVYIELFDQIDENLKLALQQDLNQMAPGLTIQAVRVT
KPKIPEAIRRNFELVEAEKTKLLIAAQKQKVVEKEAETERRKAIIEAEKVAQVAKIQYQQ
KMMKTLTEKRISELEDAAFLAREKAKADAEFYTAQKAADSNKLRLTPAYLELMKHWAIAT
NRKVYFGGSLPSHLSLGSCAFQHMAAAEAVREAPLLSKTGKLHLRPQASAT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgctccccttcatcaccacctacagggccgtgcagaccacgttgcatactgacgaggtg
aaaaacataccttgtgggacaagcggtggcgtcatgatctacattgatcggatagaggtg
gtgaacatgctggctgcgcatgcagtttacgacattgtgaggaactacacggcggattat
gacaaggccctcatcttcaacaaaatccaccacgagctcaatcagttctgtagcgtccac
actctccaggaggtctacattgaactctttgatcaaatagacgagaacctgaagctggca
ctgcagcaggacctgaatcagatggccccaggtctcaccatccaggccgtccgtgtgacc
aagcccaaaatccctgaagccatccgaagaaattttgagcttgtggaagcagagaaaacc
aagcttctgatagctgctcagaagcagaaggtggtggagaaggaagctgaaacggaacgg
aggaaagccatcatagaagcagagaaggtggctcaggtggccaagattcagtatcagcag
aagatgatgaagacattgacagagaagcgaatttctgagcttgaagatgccgcattcctg
gcaagagagaaggcgaaagcagatgccgaattctacactgcacagaaagcagccgactca
aacaagctgagactgacgccagcctacctggagctgatgaagcactgggccattgccacc
aaccgcaaggtctactttgggggcagccttcccagccacctttccctgggctcctgcgcc
ttccagcacatggcggcggcagaagctgtgagggaagctcccctcctctcaaaaacgggg
aaactccacctccggccccaagcgagcgccacgtga

DBGET integrated database retrieval system